[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56455.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->90 2bbeA PDBj 1e-04 33.3 %
:RPS:PDB   1->97 2bbeA PDBj 2e-08 26.3 %
:RPS:SCOP  1->95 1r6yA  d.58.4.11 * 3e-09 19.1 %
:HMM:SCOP  2->96 1x7vA_ d.58.4.11 * 6.2e-18 36.6 %
:HMM:PFM   1->77 PF03992 * ABM 8.3e-16 28.9 76/78  
:HMM:PFM   73->94 PF00908 * dTDP_sugar_isom 0.00066 40.9 22/177  
:BLT:SWISS 11->84 Y1783_SYNY3 1e-06 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56455.1 GT:GENE BAD56455.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1760545..1760853 GB:FROM 1760545 GB:TO 1760853 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56455.1 LENGTH 102 SQ:AASEQ MFALVVKFHLIDANKAEAFDRLVAETVQAIRDHEPGTLVYATHAVEGEPLSRVFYEVYRDRAAFDEHERQPHTRRFLDRRGEFIESFRVEFLAPAAAKGLSA GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 11->84|Y1783_SYNY3|1e-06|31.5|73/100| BL:PDB:NREP 1 BL:PDB:REP 15->90|2bbeA|1e-04|33.3|75/103| RP:PDB:NREP 1 RP:PDB:REP 1->97|2bbeA|2e-08|26.3|95/103| HM:PFM:NREP 2 HM:PFM:REP 1->77|PF03992|8.3e-16|28.9|76/78|ABM| HM:PFM:REP 73->94|PF00908|0.00066|40.9|22/177|dTDP_sugar_isom| RP:SCP:NREP 1 RP:SCP:REP 1->95|1r6yA|3e-09|19.1|94/103|d.58.4.11| HM:SCP:REP 2->96|1x7vA_|6.2e-18|36.6|93/98|d.58.4.11|1/1|Dimeric alpha+beta barrel| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------1-----------1----11-1----------------------1--2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 97.1 SQ:SECSTR cEEEEEEEE#EcTTcHHHHHHHHHTTHHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHTHHHHEEEEEEEEccEEcccc## DISOP:02AL 100-102| PSIPRED cEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEccHHHHHHHHccHHHHHHHHHHHHHHccccEEEEcccccccccc //