[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56456.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  697/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->157 1xxuA PDBj 1e-65 73.3 %
:RPS:PDB   7->157 2bmxA PDBj 9e-24 22.7 %
:RPS:SCOP  7->159 1psqA  c.47.1.10 * 1e-35 27.9 %
:HMM:SCOP  4->157 1x0rA1 c.47.1.10 * 8.9e-49 43.7 %
:RPS:PFM   10->134 PF00578 * AhpC-TSA 2e-20 44.6 %
:HMM:PFM   10->135 PF00578 * AhpC-TSA 1.7e-41 47.2 123/124  
:BLT:SWISS 8->157 Y2262_MYCBO 4e-65 73.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56456.1 GT:GENE BAD56456.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1761156..1761635) GB:FROM 1761156 GB:TO 1761635 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56456.1 LENGTH 159 SQ:AASEQ MPAEVGPLPVGTVAPDFTLKDQNNQPVTLSDYRGRKNVLLVFYPLAFTGVCQGELCKVRDELPKFQNDDAEILAISVGPPPTHKIWAAEQGYTFPLLSDFWPHGAVAQAYGVFNDKSGFANRGTFVVDKAGLIRFSEMNGPGEPRDQAAWEKALAALDS GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 8->157|Y2262_MYCBO|4e-65|73.3|150/153| BL:PDB:NREP 1 BL:PDB:REP 8->157|1xxuA|1e-65|73.3|150/153| RP:PDB:NREP 1 RP:PDB:REP 7->157|2bmxA|9e-24|22.7|150/168| RP:PFM:NREP 1 RP:PFM:REP 10->134|PF00578|2e-20|44.6|121/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 10->135|PF00578|1.7e-41|47.2|123/124|AhpC-TSA| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 7->159|1psqA|1e-35|27.9|147/163|c.47.1.10| HM:SCP:REP 4->157|1x0rA1|8.9e-49|43.7|151/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 1800 OP:NHOMOORG 879 OP:PATTERN 22----3322222232-2111---41131121-----------11-1---111--2--122334--22 222-312111111123333-321123333332222233431322222222223432131122213433322-1111-111122221113322-3212---12221731121111111111111123333323333212211---4-54553336655444344234544441324442314421221121-122111111111111111223323111235212211111145222222222222222322112-1-11-1-----1111---12-1111111111-22-----------1111111111111---------1-3113-------1-1-111-2211-21-1111-111-------111-1122-22223------1---11-----1--------------111111--1-1--1--1---1-11-----------11111111111223-21311211111--1111--1111111111211-1-21------111111111111122222211113----11111-11---111111121523----------121-32121-122123222-33422331242244311-211111111--1-------1111311332414413314333324433344243444---221-11----22321212222222222-2232222222222222222222221132222222222222222122222222122222222222212-333333233213223111212121121222111111311113444412211112112211----1---222232222232333111111111111111-1-332222------------------------------------1111111111211 1211C5--883--12----1--11111-----------------------1111--------1111-1-12-1121211212121112-331-1121111---421-2-154844472-3224285151BG7-54721128345423422421443345212233336333233324238331144244-34-17484- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 100.0 SQ:SECSTR ccHHHcEccccGGGcccccGGGGEEEEETTccTTTcEEEEEEcccTTccccHHHHHHHHHTHHHHHTTTEEEEEEEcccHHHHHHHHHHcTTGGGccccEEcTTcHHHHHHTcccTTccccEEEEEEcTTccEEEEEEEcTTccccHHHHHHHHHHHHH DISOP:02AL 1-5| PSIPRED ccccccccccccccccEEEEcccccEEEHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccccccccEEEEEccccEEEEEEEccccccccHHHHHHHHHHHHc //