[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56457.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->147 PF11253 * DUF3052 2e-28 55.8 %
:HMM:PFM   27->151 PF11253 * DUF3052 1.1e-62 64.0 125/127  
:BLT:SWISS 12->156 Y2263_MYCBO 5e-50 61.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56457.1 GT:GENE BAD56457.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1761715..1762185) GB:FROM 1761715 GB:TO 1762185 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56457.1 LENGTH 156 SQ:AASEQ MFACNYLLSGVEEDTTVVAAADAQNYAQKLGITHGMVVQELGWDEDTDDDIRADVEDACGSEMVDEDSDEVVDAVLLWWRDGDGDLADELMEVISPLADDGFIWVLTPKTGRPGHVDPSEIAEAAPTAGLTQTSAISLGSWTGSRLVQPKAPSKQR GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 12->156|Y2263_MYCBO|5e-50|61.4|145/158| SEG 62->75|emvdedsdevvdav| RP:PFM:NREP 1 RP:PFM:REP 28->147|PF11253|2e-28|55.8|120/126|DUF3052| HM:PFM:NREP 1 HM:PFM:REP 27->151|PF11253|1.1e-62|64.0|125/127|DUF3052| OP:NHOMO 70 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111121111111111---111111--111111211111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 147-156| PSIPRED cEEcHHHHHccccccccccHHHHHHHHHHHccccccHHHcccccccccHHHHHHHHHHHHHHccccccHHHEEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHcccccccccccccccccccccEEEEccccccccc //