[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56465.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  161/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->127 2f2eB PDBj 1e-23 46.9 %
:RPS:PDB   5->90 2d1hA PDBj 3e-07 16.3 %
:RPS:SCOP  9->104 1z7uA1  a.4.5.69 * 2e-24 29.2 %
:HMM:SCOP  5->145 2f2eA1 a.4.5.69 * 1.9e-33 33.3 %
:RPS:PFM   21->104 PF01638 * HxlR 4e-09 34.5 %
:HMM:PFM   20->106 PF01638 * HxlR 2.1e-19 35.6 87/91  
:BLT:SWISS 13->147 Y3122_MYCBO 5e-30 44.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56465.1 GT:GENE BAD56465.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1771724..1772191 GB:FROM 1771724 GB:TO 1772191 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56465.1 LENGTH 155 SQ:AASEQ MMRYEDLADEPCSITRPLVVLGDRWTLVILKYAFSGVRRFNAFQSAMGISRGRLQDRLDRLVEHGILVKQKAAEGAYEEYRLTRKGHDIYPVLMAIRAWGDTYMAPDGPPVRYRHRDCAGEARVRLECDSCGAEVTARDIVPELGPGLLREQSAE GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 13->147|Y3122_MYCBO|5e-30|44.4|135/158| BL:PDB:NREP 1 BL:PDB:REP 12->127|2f2eB|1e-23|46.9|113/138| RP:PDB:NREP 1 RP:PDB:REP 5->90|2d1hA|3e-07|16.3|86/98| RP:PFM:NREP 1 RP:PFM:REP 21->104|PF01638|4e-09|34.5|84/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 20->106|PF01638|2.1e-19|35.6|87/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 9->104|1z7uA1|2e-24|29.2|96/108|a.4.5.69| HM:SCP:REP 5->145|2f2eA1|1.9e-33|33.3|141/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 309 OP:NHOMOORG 164 OP:PATTERN --------------------1----------------------------------------------- 1---5---------31111-12--2411111222223443-223--------211---------1-3521--------------------------------------------------------------------------121-------------------111-----------------------------------------1---------------------------------------------------------------------------------------------------------------1-----------------------------------------------------5331------23-2---1--------------1-11-111---21-3---221223-1-1332--1-----11---------21-1-1-------------------------------2113--11-223323222222221-22222141-3484--222-----3-1----2----------------1----1-------------------------------------------------------11--1-11--1---1----------------1----------------2-2-------------------------------33311-------------------2---------2-------------------------11-----------------2222211--1--44242221-2121--1--------------------------1----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 80.6 SQ:SECSTR #EEEGGGGGGGHHHHHHHHTccHHHHHHHHHHHHcccEEHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT#Tcccccccc############################ DISOP:02AL 1-5, 146-155| PSIPRED cccccccccccccHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccHHHccccccccccHHHEEEEcccccccccccc //