[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56466.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.90.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->229 3gr3A PDBj 4e-19 30.3 %
:RPS:PDB   14->218 3bm1B PDBj 8e-23 15.6 %
:RPS:SCOP  14->229 1ds7A  d.90.1.1 * 1e-26 14.2 %
:HMM:SCOP  12->229 2b67A1 d.90.1.1 * 1.7e-42 33.8 %
:RPS:PFM   18->80 PF00881 * Nitroreductase 2e-07 38.1 %
:HMM:PFM   19->205 PF00881 * Nitroreductase 5.7e-37 30.5 154/165  
:BLT:SWISS 13->64 BLUB_RHOCA 3e-06 42.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56466.1 GT:GENE BAD56466.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1772210..1772902) GB:FROM 1772210 GB:TO 1772902 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56466.1 LENGTH 230 SQ:AASEQ MSPTSTPTAEQAALARILDGRYTCRQFRPDPVPRATIETLLRMAQRTPSWCNTQPWQVVVTEPAATDRFRKELLEHIQTATPAPDLPFPGQYTGAYRDRRRECGKQLYESVGIARGDNAGSMRQMLRNFELFDAPHVAIVTTEAELGVYGAVDSGLYIGTFLLAAQSLGLGAAPQAALAGYSPFLRSHFGIPEHRQVVAGISFGYADTEHPVNSFRTTRADLDQVVTFVD GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 13->64|BLUB_RHOCA|3e-06|42.3|52/207| SEG 162->180|llaaqslglgaapqaalag| BL:PDB:NREP 1 BL:PDB:REP 21->229|3gr3A|4e-19|30.3|201/218| RP:PDB:NREP 1 RP:PDB:REP 14->218|3bm1B|8e-23|15.6|173/177| RP:PFM:NREP 1 RP:PFM:REP 18->80|PF00881|2e-07|38.1|63/157|Nitroreductase| HM:PFM:NREP 1 HM:PFM:REP 19->205|PF00881|5.7e-37|30.5|154/165|Nitroreductase| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00881|IPR000415| RP:SCP:NREP 1 RP:SCP:REP 14->229|1ds7A|1e-26|14.2|211/217|d.90.1.1| HM:SCP:REP 12->229|2b67A1|1.7e-42|33.8|201/0|d.90.1.1|1/1|FMN-dependent nitroreductase-like| OP:NHOMO 184 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- -----1------------------13-----111111123--------------------------2-11---------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------12-1------1-------1-------------------------------------------------------------------------------------------------111211111--222---21222--------------1--3--113-----11-112---1121---------1--------------1-------------------------------2222--2211111111-----1114------21124421-111---2221213------------------------211-------------------------11---------------------1---------111-----------1----------------------------1-----------------------------------------------------------------1---------------------------2------1-1---------11111-1---1----------1-11----1111111111--------------------------------11----------------------------------------------------- ---------------1-1----------------------------11---111---------------------------------------2---------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 96.5 SQ:SECSTR ########cccHHHHHHHHcccccccEEcccccTHHHHHHHHHHTTcccGGGccccEEEEEETTHHHHHHHHHHHHHHHTTccHHHHHHHHTcTTTGGGGHHEEEccHHHHHHHHHHHHGGHEHGGGGccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHTTcEEEEEccGGGGcHHHHHHTTccTTcEEEEEEEEEEEcccccccGGGcccccHHHHccccc DISOP:02AL 1-6| PSIPRED ccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHccccccEEEEEEEcccccccccccccccccccHHHHHHHcc //