[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56470.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  45/68 : Bacteria  636/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->165 1v3wA PDBj 2e-37 43.8 %
:RPS:PDB   10->166 2eg0A PDBj 3e-25 38.9 %
:RPS:SCOP  10->169 1v3wA  b.81.1.5 * 7e-25 43.8 %
:HMM:SCOP  7->169 1xhdA_ b.81.1.5 * 8.5e-42 35.0 %
:HMM:PFM   87->102 PF00132 * Hexapep 8.9e-05 43.8 16/18  
:HMM:PFM   39->71 PF07883 * Cupin_2 6.8e-05 27.3 33/71  
:BLT:SWISS 1->171 Y3753_PSEAE 2e-50 55.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56470.1 GT:GENE BAD56470.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1775752..1776267) GB:FROM 1775752 GB:TO 1776267 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56470.1 LENGTH 171 SQ:AASEQ MRIEVGGFAPEIEESAWLAPNATVIGRVRLAAEVSVWYGAVLRGDLEQIIVGERTNIQDGCVLHADPGVPLTVGSGVSVGHNAILHGCTIGDDVLVGMGATVLNGAVVGAGSLIAANALVPEGAQIPPGSLVAGVPGKVRRELSEAERDGIRLNSAVYLHNMATHRGARTL GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 1->171|Y3753_PSEAE|2e-50|55.6|169/174| BL:PDB:NREP 1 BL:PDB:REP 4->165|1v3wA|2e-37|43.8|162/173| RP:PDB:NREP 1 RP:PDB:REP 10->166|2eg0A|3e-25|38.9|157/170| HM:PFM:NREP 2 HM:PFM:REP 87->102|PF00132|8.9e-05|43.8|16/18|Hexapep| HM:PFM:REP 39->71|PF07883|6.8e-05|27.3|33/71|Cupin_2| RP:SCP:NREP 1 RP:SCP:REP 10->169|1v3wA|7e-25|43.8|160/173|b.81.1.5| HM:SCP:REP 7->169|1xhdA_|8.5e-42|35.0|163/0|b.81.1.5|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 1052 OP:NHOMOORG 715 OP:PATTERN ------1111111111-1------1--1---1111-1211111111112132311111111122---- 11-1111111111111111-11--11111111-1111222-112-11--111111111----2-1211111---------2121111111111211---1111-111111---------------11111111111---11---113222221222211111122222222------------21111111-111111111111111111211111111221221------111-------------------1--------------------------------1--11111111111-------------1-111111111111111111112111122-111-1-----11-21-11--12-11111-22-11111-----111111111111111111111111-11111312122-111111111111131111111122111--------111-12111111111111--1-1--11-11--1111111121-111112223222111111231111113121312111213321121212111321-111111111111-32212121----------11111111-111121311---111111----------1111111222221212121111111211111122122----111------31111113222322233-2333222323222223223223111122122112111222222311222221-1-1111111111---1-11-1111113222---------------3333323111213333443324334233311111111111211111112111111111111112222--1-222222--------------------------------------111------11 ----22--422----------------------------------------------1--------------------------------11-1-1------------42-----------------------------------------------------1---------1-2331Y---335377-524443333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 97.1 SQ:SECSTR ##EcEccTTcEEcTTcEEcTTcEEEEEEEEcTTcEEcTTcEEEEEEEEEEEccccEEcTTcEEEccTTccEEEcTTcEEccccEEEccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEEETTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHT### DISOP:02AL 171-172| PSIPRED cEEEcccccEEEccccEEccccEEEEEEEEccccEEccccEEccccccEEEcccEEEccccEEEccccccEEEccccEEccccEEEccEEccccEEccccEEccccEEccccEEEEccEEcccEEEccccEEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccc //