[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56472.1
DDBJ      :             putative sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  210/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13a.4.6d.17.4
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->171 1or7A PDBj 2e-05 25.4 %
:RPS:PDB   11->172 3dxjF PDBj 2e-18 11.1 %
:RPS:PDB   180->295 3dm8A PDBj 2e-04 10.3 %
:RPS:SCOP  12->80 1h3lA  a.177.1.1 * 1e-13 30.4 %
:RPS:SCOP  106->168 1p4wA  a.4.6.2 * 2e-05 21.3 %
:RPS:SCOP  167->302 1nu3A  d.17.4.8 * 2e-05 14.7 %
:HMM:SCOP  7->81 1h3lA_ a.177.1.1 * 3e-18 38.7 %
:HMM:SCOP  81->176 1iw7F2 a.4.13.2 * 3e-09 23.9 %
:HMM:SCOP  178->295 1qjgA_ d.17.4.3 * 1.9e-14 27.7 %
:RPS:PFM   20->87 PF04542 * Sigma70_r2 6e-07 43.1 %
:RPS:PFM   119->168 PF08281 * Sigma70_r4_2 9e-05 38.0 %
:HMM:PFM   19->84 PF04542 * Sigma70_r2 4.8e-19 45.5 66/71  
:HMM:PFM   119->169 PF08281 * Sigma70_r4_2 1.5e-15 37.3 51/54  
:BLT:SWISS 7->169 FECI_ECOLI 2e-08 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56472.1 GT:GENE BAD56472.1 GT:PRODUCT putative sigma factor GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1777644..1778582) GB:FROM 1777644 GB:TO 1778582 GB:DIRECTION - GB:PRODUCT putative sigma factor GB:PROTEIN_ID BAD56472.1 LENGTH 312 SQ:AASEQ MTSFDPDAAPDTAELARRFEEHRPYLRRLAYSTLGSLSDAEDVVQEAWLRLQRHRQTAGEIENLRAWLTTVTGRLALDHLGSARARREQYVGEWLPEPEVSTWDDPADRIAQDERVTTALLVVLESLSPAERTAFVLQEVFGMSSPEVAEVVGRTPAAVRQLASRARKHVEQGTPRFPASPDEQQKVVSAFALAWRSGDLGALLGVLDDKVTLTADGGGKVPAIRQAVRGAELVAKLLLGWYQVQSNRPAWGRFVLVNGEPGLLVFDGTHTGVFAFTVDAGRIVAIDIVRNPDKLRDLPVDGQPDWFMRSED GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 7->169|FECI_ECOLI|2e-08|28.3|159/173| SEG 198->209|gdlgallgvldd| BL:PDB:NREP 1 BL:PDB:REP 39->171|1or7A|2e-05|25.4|130/181| RP:PDB:NREP 2 RP:PDB:REP 11->172|3dxjF|2e-18|11.1|162/349| RP:PDB:REP 180->295|3dm8A|2e-04|10.3|116/135| RP:PFM:NREP 2 RP:PFM:REP 20->87|PF04542|6e-07|43.1|65/70|Sigma70_r2| RP:PFM:REP 119->168|PF08281|9e-05|38.0|50/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 19->84|PF04542|4.8e-19|45.5|66/71|Sigma70_r2| HM:PFM:REP 119->169|PF08281|1.5e-15|37.3|51/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 3 RP:SCP:REP 12->80|1h3lA|1e-13|30.4|69/75|a.177.1.1| RP:SCP:REP 106->168|1p4wA|2e-05|21.3|61/87|a.4.6.2| RP:SCP:REP 167->302|1nu3A|2e-05|14.7|129/145|d.17.4.8| HM:SCP:REP 7->81|1h3lA_|3e-18|38.7|75/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 81->176|1iw7F2|3e-09|23.9|92/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 178->295|1qjgA_|1.9e-14|27.7|112/125|d.17.4.3|1/1|NTF2-like| OP:NHOMO 464 OP:NHOMOORG 212 OP:PATTERN -------------------------------------------------------------------- 117-L1--1111--67744-4511564444337666936523251B11121--1------742-3179H9----------111-----11-3-11----------2--11---------------1------1----11-----2-211-1111111-------112111---------------------2--111111-1-111111-111--111-------------24---------------------------------------------------------------------------------------------------------------------------------1----------3--1111-------2---112--2-----------1-122-13-1-22-1---112111122------11-22-11-------------1-1--------------------------------11-1111-122221-11111132111111211-1-1--11----112-2-1-----------------2----1----------------------1-823455------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---1-111111-1---11------------------------22----------------11---------------------------------------------------1- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 89.1 SQ:SECSTR ##########HHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHH#######cccHHHHHHHHHHHHHHHcccHHHHHHEEEEEEEEEEccTTTcTTcEEEEcHHHHHHHHHHHHHHEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEETTEEEEEEEEEcHHHH################# DISOP:02AL 1-10, 173-184, 309-312| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHccHHEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEccccEEEEEcccEEEEEEEEEEccEEEEEEEEEcHHHHccccccccccccccccc //