[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56480.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  241/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.135.1
:374 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->368 2gx8C PDBj 9e-32 29.5 %
:RPS:SCOP  16->127,242->368 2fywA1  c.135.1.1 * 2e-30 23.2 %
:HMM:SCOP  2->371 2gx8A1 c.135.1.1 * 3.2e-118 45.2 %
:RPS:PFM   17->127 PF01784 * NIF3 2e-21 45.9 %
:RPS:PFM   231->338 PF01784 * NIF3 2e-17 46.3 %
:HMM:PFM   7->352 PF01784 * NIF3 8e-71 37.0 238/242  
:BLT:SWISS 16->372 Y1639_MYCLE 3e-90 56.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56480.1 GT:GENE BAD56480.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1783999..1785123 GB:FROM 1783999 GB:TO 1785123 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56480.1 LENGTH 374 SQ:AASEQ MVVRLADLVAVLDAAYPPTLAESWDAVGLVCGDPEDALTRVLFAVDATAEVVAEAIDWRAQALVVHHPLLLRGVDTVAADTPKGALLHRLIRSGCALFTAHTNADSADPGVSDALADALGLAVTGPLETKPDAAVDNWTVHVPRTHTEAVLAALFAAGAGGSGAYRDCAMRVEALGQFRPVAGANPAIGTLGELQRVEEDRVEVIAPPSARAAVLAALRAAHPYEEPAFHVGERAALPSGVGLGRVGTLPEPETLRAFTTRVAAALPPTTWGVRAAGDPDRMIERVAVCGGAGDSFLGTVTRLGVDAYVTADLRHHPADEHLRAHGPALVDAAHWATEFPWCAQAEGIVRAALPDLQTRVSTLRTDPWTLAAGN GT:EXON 1|1-374:0| BL:SWS:NREP 1 BL:SWS:REP 16->372|Y1639_MYCLE|3e-90|56.6|355/385| SEG 2->15|vvrladlvavldaa| SEG 44->55|avdataevvaea| SEG 149->164|avlaalfaagaggsga| SEG 206->221|appsaraavlaalraa| BL:PDB:NREP 1 BL:PDB:REP 16->368|2gx8C|9e-32|29.5|342/364| RP:PFM:NREP 2 RP:PFM:REP 17->127|PF01784|2e-21|45.9|111/240|NIF3| RP:PFM:REP 231->338|PF01784|2e-17|46.3|105/240|NIF3| HM:PFM:NREP 1 HM:PFM:REP 7->352|PF01784|8e-71|37.0|238/242|NIF3| RP:SCP:NREP 1 RP:SCP:REP 16->127,242->368|2fywA1|2e-30|23.2|236/265|c.135.1.1| HM:SCP:REP 2->371|2gx8A1|3.2e-118|45.2|367/0|c.135.1.1|1/1|NIF3 (NGG1p interacting factor 3)-like| OP:NHOMO 246 OP:NHOMOORG 246 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-1111111-11111111111111111111111111111111111111111111111111----1-----111111111--11111111111------------------------------------1--------------------111---------------------111111111111111111111111111111111111111111111111111111111111111--111111-1--11--1-1-1--------------------------------------1---------111-1---1-11-111111-111-11--1--1111111111111111-11--1------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--------1-111111111-----1-1-------------------------------11---------------------------------------------------------------------------------------------------------------------------------------1-1---------------1111111-----------1----------------------------------------------------------------------------------------------------------- ------------------------1-------------------------1--1-----------------------------------------------------------1-----------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 345 STR:RPRED 92.2 SQ:SECSTR ###############ccGGGccTTcccEEEEccccccccEEEEEccccHHHHHHHHHHTccEEEEcccccccccccccTTcHHHHHHHHHHHTTcEEEEccHHHHHcTTcHHHHHHHHHTcEEEEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHHTTTTccTTcccccEEEEEEEEEccccc########cccEEEEEEEEEEEEEGGGHHHHHHHHHHHcccccccEEEEEEEEEEEEEEEEEEEEEEEEEEHHHHHHHHHHHHTcTccccEEEccTTcEEEEEEEEEEEcGGGHHHHHHTTccEEEEEcccHHHHHHHHHHTTcEEEEccGGGGGHHHHHHHHHHHHHTTcccEEEEcccccccc###### DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHccHHHccccccEEEEEccccccEEEEEEEEEccHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHccEEEEEEEEccccccccccEEccccHHHHHHHHHHHccccccccccEEEEEEEcEEEEEEccccccccccccEEEEEEEccEEEEEHHHHHHHHHHHHHHHcccHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccEEEEEEEEccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEccc //