[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56483.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.4
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->95 2bhtB PDBj 3e-04 38.2 %
:HMM:SCOP  100->250 2g38B1 a.25.4.2 * 0.00092 18.9 %
:RPS:PFM   168->205 PF03116 * NQR2_RnfD_RnfE 4e-04 52.6 %
:HMM:PFM   100->193 PF00823 * PPE 3.4e-08 22.3 94/159  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56483.1 GT:GENE BAD56483.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1786630..1788015) GB:FROM 1786630 GB:TO 1788015 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56483.1 LENGTH 461 SQ:AASEQ MVAGLDIVKAALAGMGQPVLAWGVDGHQRSAENNARDESLREDGAKFWEGDRQHIQNEWGQLSSQYNNPAPQAITNPESFETWTHQQIWEALNGKGDQRGVEQAEINAGADGWRRLCEQATLAIDTFENGVEEDIDRLWKGRASNAAMDATLSYAKDFRQLTVGFQQVANGIDLIQGYLDQAKRSVAPPEEVSWVDEFLGHIPGNGVLKLGQHRANEATAHAQEVMKVYQQGAETVDKQTPILPEPTNPVSNPGTPPGGGGSGTPGGNPGAGTPGTNPAGTNPSGNPNTPAAQDPSSRNDPTAGDDPADDSPYEDPQGTNPQSSEPQSTVPQSTVPSAAPPGSSLSDPSGRPNSSTPSLGSPGLGAPGLGSPGATPSPGSSVPGAKTAQPTGLGTAATRAATGAAGRAGMPGMGAMGAGAGRRGDEDESEHQIPDYLVQDRTTELLGEQPRVLPPGGVIGG GT:EXON 1|1-461:0| SEG 246->291|ptnpvsnpgtppggggsgtpggnpgagtpgtnpagtnpsgnpntpa| SEG 352->385|pnsstpslgspglgapglgspgatpspgssvpga| SEG 394->424|gtaatraatgaagragmpgmgamgagagrrg| BL:PDB:NREP 1 BL:PDB:REP 36->95|2bhtB|3e-04|38.2|55/280| RP:PFM:NREP 1 RP:PFM:REP 168->205|PF03116|4e-04|52.6|38/312|NQR2_RnfD_RnfE| HM:PFM:NREP 1 HM:PFM:REP 100->193|PF00823|3.4e-08|22.3|94/159|PPE| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03116|IPR004338| GO:PFM GO:0016020|"GO:membrane"|PF03116|IPR004338| HM:SCP:REP 100->250|2g38B1|0.00092|18.9|148/0|a.25.4.2|1/1|PE/PPE dimer-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 11.9 SQ:SECSTR ###################################ccTTTGGGTcccccTTcccccTTTcEEccTTTcT#####HHHHHHHHTHHHHHHHHTTTc############################################################################################################################################################################################################################################################################################################################################################################## DISOP:02AL 1-2, 28-42, 136-454, 456-461| PSIPRED ccccHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //