[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56484.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->177 PF12079 * DUF3558 1.2e-33 38.8 152/168  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56484.1 GT:GENE BAD56484.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1788464..1789000) GB:FROM 1788464 GB:TO 1789000 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56484.1 LENGTH 178 SQ:AASEQ MRIAVVLRAIVAAVGVVGVVGCGTTVDGTPTESAAKPSDAQFNPCTDISDDVLRGTGVDPASKDVVTDAAGPSAWRICSWDAIDLPYYLVVASSINTVADVRNNDKETGFREVAIGPRTGLVHQDKSDTKGTDCRVAIPAEQGMFVISASWRTSETITRDRCELAIGHARDLEPHLPD GT:EXON 1|1-178:0| TM:NTM 1 TM:REGION 3->25| SEG 4->31|avvlraivaavgvvgvvgcgttvdgtpt| HM:PFM:NREP 1 HM:PFM:REP 16->177|PF12079|1.2e-33|38.8|152/168|DUF3558| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------31-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-67| PSIPRED cEEEHEEHHHHHEEEEEEEEEcccccccccccccccHHHcccccccccHHHHHHHcccccccccccccccccccEEEEEEccccccEEEEEEEcccHHHHHHcccccccEEEEEEEcccEEEEEEccccccccEEEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHHccccc //