[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56487.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->179 2pfeA PDBj 6e-10 38.7 %
:HMM:SCOP  28->205 2sfaA_ b.47.1.1 * 5.2e-19 28.4 %
:HMM:PFM   58->179 PF00089 * Trypsin 3.3e-06 30.0 120/219  
:BLT:SWISS 58->179 SP1_RARFA 1e-09 37.5 %
:PROS 58->63|PS00134|TRYPSIN_HIS
:PROS 157->168|PS00135|TRYPSIN_SER
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56487.1 GT:GENE BAD56487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1791364..1792053 GB:FROM 1791364 GB:TO 1792053 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56487.1 LENGTH 229 SQ:AASEQ MAAAAAVVAGVGTAVTGAAQAAPGGAVLGGGSGLIFENNSACSLTAIGYDNANRLVGLTAGHCAPTGARLAAESALDAGVVGVVAYSDNGEGLDFAVLQFDPAKVTPVRTVGPTTINGLGATPTPGTTVCSNGRTSGSGCGVVWGNLDETVTLNQACSKPGDSGGPVTVGDRLVGMNQGRVTGISGIRFDLPCSSSANPIHSPAYFAPIEVILTAVDAIGGVGAGFRTA GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 58->179|SP1_RARFA|1e-09|37.5|120/525| PROS 58->63|PS00134|TRYPSIN_HIS|PDOC00124| PROS 157->168|PS00135|TRYPSIN_SER|PDOC00124| SEG 2->33|aaaaavvagvgtavtgaaqaapggavlgggsg| BL:PDB:NREP 1 BL:PDB:REP 59->179|2pfeA|6e-10|38.7|111/186| HM:PFM:NREP 1 HM:PFM:REP 58->179|PF00089|3.3e-06|30.0|120/219|Trypsin| HM:SCP:REP 28->205|2sfaA_|5.2e-19|28.4|176/0|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 43 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-12111111111111113432----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 72.1 SQ:SECSTR #################################cEEEcccEEEccEEEEcTTccEEEEEcGGGccTTcEEcTTTEEEEEEEEEEEccEEcccccEEEEEEcTTcEEEEccccEEEccccccccTcTcEEEEEETTTEEEEEEEEEEEEEEEEEEcccccTTcTTcEEEETTEEEEEEEEEcccTTcccTTccGGGccE############################### DISOP:02AL 227-229| PSIPRED ccHHHHHHHHHccccccccccccccccccccccEEEccccEEEEEEEEEcccccEEEEEEEcccccccEEEEcccccccEEEEEEEEEcccccEEEEEEEcccEEEEccccccEEEEEEccccccccEEEEEccEEcccccEEEccccEEEEEEEEccccccccccEEEccEEEEEEEcccccccccccccccccccccEEccEEEEEHHHEEEHHHccccccccEEEc //