[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56491.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->52 PF10812 * DUF2561 1.3e-05 38.5 39/207  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56491.1 GT:GENE BAD56491.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1795448..1795780 GB:FROM 1795448 GB:TO 1795780 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56491.1 LENGTH 110 SQ:AASEQ MRVVRSLVAGAFIAGAASVLAVLGAGSANAVAVTPLPGGVQVDLSHADTKWVADNNFGRVIGSLPHPSAPSFGEALDAAAELSSQYPTGRVTFTVFGPLDQLNGTMLALQ GT:EXON 1|1-110:0| TM:NTM 1 TM:REGION 9->31| SEG 14->28|agaasvlavlgagsa| HM:PFM:NREP 1 HM:PFM:REP 14->52|PF10812|1.3e-05|38.5|39/207|DUF2561| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEcccccEEEcccccccEEEcccccccccHHHHHHHHHHHHccccccEEEEEEEccHHHcccEEEEEc //