[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56495.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->79 PF01298 * Lipoprotein_5 2.6e-05 25.8 66/593  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56495.1 GT:GENE BAD56495.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1799093..1799527) GB:FROM 1799093 GB:TO 1799527 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56495.1 LENGTH 144 SQ:AASEQ MPHSRWISRSPMLVAAAFAVAALSACGTSGDPNPAGSSGPTTSSAPTTQAPTTQRPEPQVSAAAAQKLCDAIRPELSNFRVQGPTLGRVGLNLIVHPWGLQNGIDVLNNKTVVDTATSKSCPDVRQQAIEALEVPDLATVVVGL GT:EXON 1|1-144:0| SEG 13->25|lvaaafavaalsa| SEG 34->54|pagssgpttssapttqapttq| HM:PFM:NREP 1 HM:PFM:REP 14->79|PF01298|2.6e-05|25.8|66/593|Lipoprotein_5| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 44-60| PSIPRED cccHHHHHHcHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEccccccccHHHHHccEEEEcccccccHHHHHHHHHHHccccHHHHHHcc //