[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56498.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->127 3bqxA PDBj 2e-05 37.2 %
:RPS:PDB   6->123 2a4wA PDBj 2e-09 14.4 %
:RPS:SCOP  3->124 1xy7A  d.32.1.9 * 4e-14 25.7 %
:HMM:SCOP  1->127 1u7iA_ d.32.1.7 * 2.2e-23 32.0 %
:HMM:PFM   6->122 PF00903 * Glyoxalase 1.1e-12 20.5 117/128  
:BLT:SWISS 4->124 Y911_MYCBO 2e-15 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56498.1 GT:GENE BAD56498.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1801490..1801876 GB:FROM 1801490 GB:TO 1801876 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56498.1 LENGTH 128 SQ:AASEQ MHSSLHPKLLVSDADAAITYYTRALDAVVDLRVADDDGSVTHAELSIGTATFALAHSVPEWGWRDPESIGGSPVLIMLTVPDPGATAAQMVRHGGELVIPVENRPYGRRQGRVRDPFGHLWVLGGEPR GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 4->124|Y911_MYCBO|2e-15|38.0|121/170| SEG 23->37|raldavvdlrvaddd| BL:PDB:NREP 1 BL:PDB:REP 85->127|3bqxA|2e-05|37.2|43/136| RP:PDB:NREP 1 RP:PDB:REP 6->123|2a4wA|2e-09|14.4|118/128| HM:PFM:NREP 1 HM:PFM:REP 6->122|PF00903|1.1e-12|20.5|117/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 3->124|1xy7A|4e-14|25.7|113/120|d.32.1.9| HM:SCP:REP 1->127|1u7iA_|2.2e-23|32.0|122/134|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 94 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- 121-----------11111-11--11111111111121---1---1----------------1--------------------------------------------------------------------------------------1----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------11--1-----------------------------1-------------------------------------11-1111111-111---11111---111------111--------1--11------------------1----------------1-1-1-1--121213--------------------------------------1--1111------------------------------------------------------------------------------------------------------------------11111------1----------------------------------1---1111---------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 100.0 SQ:SECSTR GGcccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcGGGcEEEEEEHHHHHTTcTTccccccccccEEEEcccHHHHHHHHHHHHHTTccEEEEEEEcTTcEEEEEEEcTTccEEEEEEcHH DISOP:02AL 127-128| PSIPRED cccEEEEEEEEccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEccEEEEEEEccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEccc //