[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56500.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:HMM:PFM   100->167 PF04186 * FxsA 0.00056 25.4 63/120  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56500.1 GT:GENE BAD56500.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1802895..1803569) GB:FROM 1802895 GB:TO 1803569 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56500.1 LENGTH 224 SQ:AASEQ MVSALLLLVAAGQLACVGVLWTRVTRVPRVWLLGVVGVGLAYDSAVIGLGAVLGEGAFLHVLSVPRFVAHAVLTPLLIVWAADRLGARRGAEDGRRDRSVSAARGWWWTAVVLTGALLAGGVLIELPHLRLVPREYADTLRYAAEHPAPPVPALVVGIVMLAAGIVLWRKESARALVFGTVALIGASAAAVAVPPLGNVGEAALLVGLVAAELRARPESVGVTV GT:EXON 1|1-224:0| TM:NTM 6 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 62->84| TM:REGION 108->130| TM:REGION 147->168| TM:REGION 183->205| SEG 2->20|vsallllvaagqlacvgvl| SEG 32->40|llgvvgvgl| SEG 81->98|aadrlgarrgaedgrrdr| SEG 109->123|tavvltgallaggvl| SEG 181->193|valigasaaavav| SEG 196->216|lgnvgeaallvglvaaelrar| HM:PFM:NREP 1 HM:PFM:REP 100->167|PF04186|0.00056|25.4|63/120|FxsA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHcccHHccccc //