[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56501.1
DDBJ      :             putative CoA-transferase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  366/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
c.123.1
:407 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->407 2vjoA PDBj 1e-38 31.2 %
:RPS:PDB   86->195 2c9eA PDBj 5e-33 12.7 %
:RPS:SCOP  11->407 1xa3A  c.123.1.1 * 9e-94 27.6 %
:HMM:SCOP  9->407 1q7eA_ c.123.1.1 * 3e-132 44.7 %
:RPS:PFM   78->267 PF02515 * CoA_transf_3 8e-42 48.7 %
:HMM:PFM   78->267 PF02515 * CoA_transf_3 1.3e-66 44.7 190/191  
:BLT:SWISS 3->407 CG010_RAT 3e-57 31.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56501.1 GT:GENE BAD56501.1 GT:PRODUCT putative CoA-transferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1803574..1804797) GB:FROM 1803574 GB:TO 1804797 GB:DIRECTION - GB:PRODUCT putative CoA-transferase GB:PROTEIN_ID BAD56501.1 LENGTH 407 SQ:AASEQ MNPSDTTETPGALDGIRVLEVGTLISGPFAARLLGDMGAEVLKIEPPDRPDPLRTWGQAERDGHHFFWTVHARNKKALTLNLREPAGRDLFLELVARSDIVVENFRPGTLEKWGLDYETLRARNRGIILVRVSGYGQTGPDAHKAGYASVAEAASGLRHMNGFPGGPPPRLALSLGDSLAGMFAVQGALAALYRRTVTGEGQVVDAALTESCLAIQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYRSADGSWVVIAANQDTVFRRLCAAMGQPELADDPRFADHVARGRNQDELDRIIGDWAAQRQPDDIIATLNAAGVISGPINTVAEVVRDPQLRSRGMIAEHYDERIGRAVLGPGIVPVLSQTPGRIRNAGSAHPGQHNEEIYRGLLGKSAEELAELRAAGVV GT:EXON 1|1-407:0| BL:SWS:NREP 1 BL:SWS:REP 3->407|CG010_RAT|3e-57|31.9|398/436| BL:PDB:NREP 1 BL:PDB:REP 13->407|2vjoA|1e-38|31.2|375/427| RP:PDB:NREP 1 RP:PDB:REP 86->195|2c9eA|5e-33|12.7|110/317| RP:PFM:NREP 1 RP:PFM:REP 78->267|PF02515|8e-42|48.7|189/189|CoA_transf_3| HM:PFM:NREP 1 HM:PFM:REP 78->267|PF02515|1.3e-66|44.7|190/191|CoA_transf_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02515|IPR003673| GO:PFM GO:0008152|"GO:metabolic process"|PF02515|IPR003673| RP:SCP:NREP 1 RP:SCP:REP 11->407|1xa3A|9e-94|27.6|384/400|c.123.1.1| HM:SCP:REP 9->407|1q7eA_|3e-132|44.7|394/417|c.123.1.1|1/1|CoA-transferase family III (CaiB/BaiF)| OP:NHOMO 2581 OP:NHOMOORG 543 OP:PATTERN --1----232523322-11421-51--12-32-----------------------------1-2---- --2351-2---1-15TH44-4G--DS444449FDIE5HRj-N3Y1--2----442212--12B123C6635-111----1616------------------2------12--------------------------66686---32----------------------------------------22---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12--2222222-2--3-------1---1----87-1----1--------2--633A-----2-KBD--7B59A633442443442-34A33E39855-41111222133296472759222426722222222511--623------------------------------47F8-5taHfEDDFIF5577799GE887858V7TRdlc1678464898N8HAPT456----21----------922-121-----2------2--3----111111-6---------------------------1---1-4-3--1------1----1-11-1--------------1-2-3--3333333333-2333333333233223221------111111111111111111122333321----------------------1111-2212---------------44324242222155553656342455223------------------------------------------111111------------------------------------------------- ----111-----1126565655378773311112225666555333334857D9668124333-1---------1------111-1---35454343111213433-2-23252222112222223251AV3-633222131222212222115-532823212222232A1222-11-----111--83---11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 97.5 SQ:SECSTR ##########cTTTTcEEEEcccTTHHHHHHHHHHHTTcEEEEEEcTTTccGGGccccccTTcccHHHHTTcTTcEEEEcccccHHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTcTTccccHHHHHHHHHHHHHHHHTccHHHHHHHHHccccEEEEEHHHHHHHHTHHHHHHHHHcccTTcGGccTTTTcGcTTccccTTccEEEccGGcGGGHHHHHHHTTcGGGcccTTTccHHHHTTTHHHHHHHHHHTTTTccHHHHHHHHHTTTccEEEcccHHHHHTcHHHHHTTcEEEEccTEEcccccccccccccccccccccccccccTTccHHHHHHHHTTccHHHHHHHHHTTcc DISOP:02AL 1-10| PSIPRED ccccccccccccccccEEEHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccEEEEcccHHHHHHHcccHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccEEEEEEccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccEEEcccHHHHHcccHHHHccEEEEEccccccccEEEcccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHcccc //