[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56508.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->80 PF00381 * PTS-HPr 1.6e-05 29.2 72/84  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56508.1 GT:GENE BAD56508.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1814000..1814326) GB:FROM 1814000 GB:TO 1814326 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56508.1 LENGTH 108 SQ:AASEQ MYYEQVTVAGGLTAVDAEELAQVAGRYRARVTFTAHGRSVHAPVLPYCWDVLRVAAGDTVAVTVEAGPSADEERAALREVAARLGTFAPAQEPKTRSTTALARRVMRR GT:EXON 1|1-108:0| SEG 70->83|adeeraalrevaar| HM:PFM:NREP 1 HM:PFM:REP 6->80|PF00381|1.6e-05|29.2|72/84|PTS-HPr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,53-53,59-60,62-62,67-67| PSIPRED cccEEEEEEcccccccHHHHHHHHccEEEEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcc //