[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56509.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.151.1
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   112->327 1e9nA PDBj 5e-14 16.7 %
:RPS:SCOP  129->327 1wduA  d.151.1.1 * 8e-11 14.5 %
:HMM:SCOP  109->327 2ddrA1 d.151.1.3 * 2.4e-25 26.6 %
:RPS:PFM   125->325 PF03372 * Exo_endo_phos 2e-04 33.5 %
:HMM:PFM   126->325 PF03372 * Exo_endo_phos 1.9e-10 20.7 198/276  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56509.1 GT:GENE BAD56509.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1814366..1815355 GB:FROM 1814366 GB:TO 1815355 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56509.1 LENGTH 329 SQ:AASEQ MRVASRPLAGPPRVGDMRMWTMRAVLGLGWCGLLVGIAGIVLHLRGWRSQWPALVASGASYFMLGALVALLLFLIVRGWRSAAVAGVVVAAVVWTQLPAFLPDGRAASGPELRVLQSNLLFGGSDLDAVVWEVRGRGVELLTVQELTPDAAHQLTADLAADLPYHHLEPGPGGAGTGIFSRYPLHDTRKLDGFLLANLSATMDHPQRGPVTVFAVHPVPPPMNFPAWSAEMRRLREVLDVQQGPAVVGGDFNATMDHALFRDLLRGRFASAAELAGAGPLPTWPADRAWGPVIGIDHVLVADGGAGRVESITIPGSDHRAVYAELRLPG GT:EXON 1|1-329:0| TM:NTM 3 TM:REGION 22->44| TM:REGION 53->75| TM:REGION 80->102| SEG 25->36|vlglgwcgllvg| SEG 64->74|lgalvalllfl| SEG 82->93|aavagvvvaavv| RP:PDB:NREP 1 RP:PDB:REP 112->327|1e9nA|5e-14|16.7|216/274| RP:PFM:NREP 1 RP:PFM:REP 125->325|PF03372|2e-04|33.5|197/261|Exo_endo_phos| HM:PFM:NREP 1 HM:PFM:REP 126->325|PF03372|1.9e-10|20.7|198/276|Exo_endo_phos| RP:SCP:NREP 1 RP:SCP:REP 129->327|1wduA|8e-11|14.5|193/217|d.151.1.1| HM:SCP:REP 109->327|2ddrA1|2.4e-25|26.6|218/0|d.151.1.3|1/1|DNase I-like| OP:NHOMO 49 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------1------1----------31-12211-111----11--111-----111-1-1221-3222222--1-----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 71.1 SQ:SECSTR #############################################################################################cccccccccccTTcccccEEEEEEEcccHHHHHHTTHHHHHHHHcccEEEEEcccccGGGccTHHHHcccccEEEcccccccEEEEEcccccEEEEccccGGGcccccEEEEEccccEEEEEEcccccGGGTTHHHHHHHHHHHHHHHHHcEEEEEEccccccGGGccccGGGTTccHHHHHHHHHHHHHTTTTTTTcEEccEEEEEcGGGGGGEEEEEEcccccccEEEEEcc## DISOP:02AL 1-8, 100-110| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccEEEEEccccccccEEEEEcccccccccccccccccEEEEEEEcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHccHHHHHHHHcccccccccccccccccccEEEEEEccccEEEEEEcccccccccEEEEEEEccc //