[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56514.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:HMM:PFM   39->142 PF06271 * RDD 4.4e-13 27.2 103/133  
:BLT:SWISS 37->130 YJCD_ECOLI 2e-04 41.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56514.1 GT:GENE BAD56514.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1820413..1820865 GB:FROM 1820413 GB:TO 1820865 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56514.1 LENGTH 150 SQ:AASEQ MACITGSWLTGPEADPGDPAASEYRGEQLGLPREGAGSLASMGRRVAAMFVDWLIAVGISLMIARGVNANLPLLIWFVIGIAAVTLFGFTPGQYFLRLRTVRIDAPVPVGFVRALARQVLLVFVVPALFTDGDGRGMHDRATGTALVNAR GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 37->130|YJCD_ECOLI|2e-04|41.3|75/449| TM:NTM 2 TM:REGION 58->80| TM:REGION 106->128| HM:PFM:NREP 1 HM:PFM:REP 39->142|PF06271|4.4e-13|27.2|103/133|RDD| OP:NHOMO 49 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--1111111111111111----11111--11--1-1-----1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHEEEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHEEccc //