[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56515.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.109.1
:247 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  144->196 1m4jA  d.109.1.2 * 1e-04 24.5 %
:HMM:PFM   10->105 PF09972 * DUF2207 5.6e-06 17.2 93/511  
:BLT:SWISS 32->247 Y2219_MYCTU 4e-59 52.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56515.1 GT:GENE BAD56515.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1820878..1821621) GB:FROM 1820878 GB:TO 1821621 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56515.1 LENGTH 247 SQ:AASEQ MAAGKGGKPSKEAKAAAKAARKQASKERRQQLWQAFQMQRKEDKLLLPLMIGALVGITALFLVIGFVFGIPWFLLPIGILLGALVAFIIFGRRVQRSVYAKAEGQAGAAAWVLDNLQGKWRVSNGVAATTQLDAVHRVIGLPGVILIGEGSPQRLKALIAQEKKRTARLIGDTPIYDFVIGNEEGQVPLKNLQRHLTKLPRNIDTKRMDLIEGRLSALSRRTGPALPKGPMPAGAKMKGMQRTIRRR GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 32->247|Y2219_MYCTU|4e-59|52.3|216/100| TM:NTM 2 TM:REGION 45->67| TM:REGION 70->91| SEG 2->31|aagkggkpskeakaaakaarkqaskerrqq| SEG 100->110|akaegqagaaa| HM:PFM:NREP 1 HM:PFM:REP 10->105|PF09972|5.6e-06|17.2|93/511|DUF2207| RP:SCP:NREP 1 RP:SCP:REP 144->196|1m4jA|1e-04|24.5|53/133|d.109.1.2| OP:NHOMO 64 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-111111111111111111111111111-1111111111--11111111111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-31, 218-247| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccEEEEEccccEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccc //