[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56517.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56517.1 GT:GENE BAD56517.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1823945..1824394) GB:FROM 1823945 GB:TO 1824394 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56517.1 LENGTH 149 SQ:AASEQ MNRSLTRLACLAGALVALPLLAAGPAQAQPGAVHFSMGGLNCAIFDNGTVGCDLPTATPLQYGQLPFAIPVHEIVMDIPWLPAHPTFDPGTPYTLPGGNPPIDQVKTGDGQWGPFVEHAGVHCYVGFHGSVGCTAGGRGWSMWSGRISA GT:EXON 1|1-149:0| TM:NTM 1 TM:REGION 5->27| SEG 8->33|laclagalvalpllaagpaqaqpgav| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 148-149| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccEEEEEEcccEEccccccccccccccccEEccHHHHHHccccccccccccccccEEccccccccccEEccccccccHHHcccEEEEEEEccccccccccccEEEcccEEcc //