[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56518.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->82 PF05901 * Excalibur 0.00012 61.5 13/37  
:HMM:PFM   4->40 PF10738 * Lpp-LpqN 0.00095 34.3 35/241  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56518.1 GT:GENE BAD56518.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1824613..1824867) GB:FROM 1824613 GB:TO 1824867 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56518.1 LENGTH 84 SQ:AASEQ MRFAVTLGASAVAAAAFVLTAPATASAEPSNCHPSYTPCVPITSDVDCVGGSGNGPAYTGRVTVIGPDEYDLDRDGNGIGCENS GT:EXON 1|1-84:0| TM:NTM 1 TM:REGION 3->24| SEG 3->27|favtlgasavaaaafvltapatasa| HM:PFM:NREP 2 HM:PFM:REP 70->82|PF05901|0.00012|61.5|13/37|Excalibur| HM:PFM:REP 4->40|PF10738|0.00095|34.3|35/241|Lpp-LpqN| OP:NHOMO 15 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------21-----111113------1---------11---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 24-34, 82-84| PSIPRED ccEEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccccc //