[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56521.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->122 PF05331 * DUF742 4e-13 50.0 %
:HMM:PFM   13->122 PF05331 * DUF742 3.4e-32 42.7 110/114  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56521.1 GT:GENE BAD56521.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1830140..1830508 GB:FROM 1830140 GB:TO 1830508 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56521.1 LENGTH 122 SQ:AASEQ MSEEPYYLDDTGPRLARPYAVTRGRTESAVDLPLEAMIETCRDVGFDAFHVAHARIVALCHTPLSVAEIAAELDLALGVARVLIGDLLVEGIVRRHQTITADASREQWMHLLERTLQGLRAL GT:EXON 1|1-122:0| RP:PFM:NREP 1 RP:PFM:REP 15->122|PF05331|4e-13|50.0|106/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 13->122|PF05331|3.4e-32|42.7|110/114|DUF742| OP:NHOMO 62 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----1----------1111-11--1111111111113111-223----------------32--3534343---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccccccccEEccEEEEccccccccccEEEEEEEEEcccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHHHcc //