[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56522.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   58->119 PF03707 * MHYT 4.1e-14 34.4 61/62  
:HMM:PFM   121->181 PF03707 * MHYT 4.1e-15 45.9 61/62  
:HMM:PFM   183->213 PF03707 * MHYT 2.4e-09 35.5 31/62  
:BLT:SWISS 48->143 Y3311_PSEAE 3e-11 39.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56522.1 GT:GENE BAD56522.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1830543..1831292 GB:FROM 1830543 GB:TO 1831292 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD56522.1 LENGTH 249 SQ:AASEQ MHHHVHHFEMGAWLMWLAYLVSVIGSIVGLAAARRSLSARTDGQRLGWLWMSAVAIGGVGIWLMHFIAMLGFAVPGVPLRYDMTWTAGSAVLAIVAVFAGLLVVGTSVSAPRLLAGGLITGLAVNIMHYAGMNAVRFQGEIHYNRWLVALSVLIAVVAATVALLFTLILDSVLMRLLGGLVMGVAVVGMHYTGMAAVSVTVDQSIPVPEGAEVFSFLFPVFVMGLLGLAVPITVLLISDPDDLAASEPV GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 48->143|Y3311_PSEAE|3e-11|39.8|93/783| TM:NTM 7 TM:REGION 12->33| TM:REGION 52->74| TM:REGION 86->108| TM:REGION 110->132| TM:REGION 145->167| TM:REGION 177->199| TM:REGION 216->238| SEG 30->40|laaarrslsar| SEG 147->169|lvalsvliavvaatvallftlil| SEG 172->189|vlmrllgglvmgvavvgm| HM:PFM:NREP 3 HM:PFM:REP 58->119|PF03707|4.1e-14|34.4|61/62|MHYT| HM:PFM:REP 121->181|PF03707|4.1e-15|45.9|61/62|MHYT| HM:PFM:REP 183->213|PF03707|2.4e-09|35.5|31/62|MHYT| OP:NHOMO 116 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------4111---4--------------------1--22-----------------------------------------------------------------------------------------------1--------------------------1-------------------11------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-1--111-11-1---11-11------1--------------------11----------------------------------------111--------11111--111111112-1--------------------11--1------------1----------------------------------------------------------------------11--------1---------------------------1--2---------------------------------------1-11111111-1111-------------------------------------------------------------------111-11-2221111--1-------------------------22-----112--------------------------------------------------------------- --------------------1111-1-------------------------1-31-------------------------------------------------1---------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 245-249| PSIPRED cccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHccccccc //