[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56523.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56523.1 GT:GENE BAD56523.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1831586..1831924 GB:FROM 1831586 GB:TO 1831924 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56523.1 LENGTH 112 SQ:AASEQ MQDLTSAAGLTDEWDRMVVVFPGTSEATLNSDAGTTGVCWANLPGAYGDDTPHTAYYLFVAGGQPVQAIHWFYPSDRALDFLRPRRSVIHPSTLLTPVHTAGAEPFLRPSTE GT:EXON 1|1-112:0| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 110-112| PSIPRED cccccccccccccccEEEEEcccccHHHHHHHccccccccccccccccccccccEEEEEEEccccEEEEEEEccccccHHHcccccEEEccccccccccccccccccccccc //