[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56524.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->46 PF07542 * ATP12 0.00081 22.9 35/122  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56524.1 GT:GENE BAD56524.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1832004..1832285) GB:FROM 1832004 GB:TO 1832285 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56524.1 LENGTH 93 SQ:AASEQ MRRYYVKVHCCGPHWLIHVPAVDRWTVTTDKKSIRTAARHMIAAATGRDATSFELDLVAGRAVRDADEFAVGSTLLRRWDPSPDDLGRQPPVS GT:EXON 1|1-93:0| HM:PFM:NREP 1 HM:PFM:REP 4->46|PF07542|0.00081|22.9|35/122|ATP12| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 86-93| PSIPRED ccEEEEEEEEEcccEEEEcccccEEEEEccHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHccccHHHcccccccc //