[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56525.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->88 2a6cA PDBj 7e-07 19.7 %
:RPS:SCOP  27->82 1y7yA1  a.35.1.3 * 3e-06 27.8 %
:HMM:SCOP  20->82 1y9qA1 a.35.1.8 * 5.2e-05 32.8 %
:HMM:PFM   33->82 PF01381 * HTH_3 2.2e-05 31.2 48/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56525.1 GT:GENE BAD56525.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1832730..1833656 GB:FROM 1832730 GB:TO 1833656 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD56525.1 LENGTH 308 SQ:AASEQ MGDRDVRAEAPQLAADVRGTAGVPHRSLGRCLRGMRQEAGLSIEVAARAIGRGVGTLHRLETGAPNVVVREEDLRRLCKLYQQVEMLPVLKSLAAQGKSPSWLDEFPDQVHPTFNAYLQMEAAATKLTGYRPDLLPGLFQIPDYARALDRAFFPEDTVEDLERRVRVRRNRQRLITRELAPLTAELVLDEAVIRRVVGGPRVMSAQLRHLADLPPNVRVHVLPFRAGFPLGTSTGPFTILDFTRDRDGRPTEPSVVYVESYTGDLYLERDSTVRKYRAGVEAMRRVALNAPDSKRLLRHVAKEFDCVR GT:EXON 1|1-308:0| SEG 163->173|rrvrvrrnrqr| RP:PDB:NREP 1 RP:PDB:REP 26->88|2a6cA|7e-07|19.7|61/72| HM:PFM:NREP 1 HM:PFM:REP 33->82|PF01381|2.2e-05|31.2|48/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 27->82|1y7yA1|3e-06|27.8|54/69|a.35.1.3| HM:SCP:REP 20->82|1y9qA1|5.2e-05|32.8|61/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 175 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----6-------------------------------A----557----------------GG--I8NILAC---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 38.3 SQ:SECSTR #######################cHHHHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHTTcGGGccccHHHHHHHHHTTcccccccHHTTccccHHHHHHHHHHHHHHcGGGHHHHHHHHGGGTTccHHHHHHHHHHHH####################################################################################################################################################################### DISOP:02AL 1-4, 6-21| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEEEccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccc //