[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56526.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->40 PF08919 * F_actin_bind 0.00034 32.4 34/179  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56526.1 GT:GENE BAD56526.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1833740..1833958 GB:FROM 1833740 GB:TO 1833958 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56526.1 LENGTH 72 SQ:AASEQ MWASATPRTPQAGRWCSRPRSGMPSSRVRVPESSTVPDVLGRASPARPMAERFVKQPENRRGSETGAGITRD GT:EXON 1|1-72:0| HM:PFM:NREP 1 HM:PFM:REP 5->40|PF08919|0.00034|32.4|34/179|F_actin_bind| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 18-30, 51-72| PSIPRED cccccccccccccccccccccccccccEEcccccccHHHHcccccccHHHHHHHHccccccccccccccccc //