Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56529.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56529.1 GT:GENE BAD56529.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1836124..1836672 GB:FROM 1836124 GB:TO 1836672 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56529.1 LENGTH 182 SQ:AASEQ MQGSEMARVRQVISPMVLLWMLVVVVGLLAFMAGVLHLGMAIARWSGSDVAMALFLPVSAVAGIGAWSVVLSAAWWLRRRYLRRVGVAVPDATVVESQVRRKRMRALFDFDLWQVTVEARFSHPDSGSAVRVRKQYSFHQFRAAAARRFADRLSVGSSAPVVVRRNAAMFDVPQRPIWVDIW GT:EXON 1|1-182:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 51->73| SEG 17->29|vllwmlvvvvgll| SEG 73->84|aawwlrrrylrr| SEG 141->150|fraaaarrfa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEHHccccccccEEEHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEcccccEEEEEc //