[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56530.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->108 PF05901 * Excalibur 0.00033 57.1 14/37  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56530.1 GT:GENE BAD56530.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1836987..1837319) GB:FROM 1836987 GB:TO 1837319 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56530.1 LENGTH 110 SQ:AASEQ MRTATTFALTSGAALALAFTAPLTATADPLTDFLCTSGSAQFCPPSPPVAPPPRSQDCHPSYDPCLPRVSDVDCAGGSGDGPVYTGRVRVIGPDDYDLDRDGNGIGCESS GT:EXON 1|1-110:0| SEG 3->32|tattfaltsgaalalaftapltatadpltd| SEG 44->53|ppsppvappp| HM:PFM:NREP 1 HM:PFM:REP 95->108|PF05901|0.00033|57.1|14/37|Excalibur| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------------------21-----11-1-3------1---------11---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 34-62, 108-110| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccc //