[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56531.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   69->119 PF08808 * RES 0.00069 17.6 51/170  
:PROS 37->43|PS00290|IG_MHC
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56531.1 GT:GENE BAD56531.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1837501..1838037 GB:FROM 1837501 GB:TO 1838037 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56531.1 LENGTH 178 SQ:AASEQ MSESRRLPGRYCHGRSGLVGRSGGRVRGAGGPPRMRYACYAHHPDGRMEIPVHAGARAAPGAIVQVMLAPQVVREADGSFSARYPSQDWSVAGATREAAIGALVVESRRRMRDPAYVAAHYEVTLRHVRGEQTTPGIEIAVLSSEQYVERIGRLGARLRRGWQAPGPAGDDGLGGRGR GT:EXON 1|1-178:0| PROS 37->43|PS00290|IG_MHC|PDOC00262| SEG 14->36|grsglvgrsggrvrgaggpprmr| SEG 150->161|rigrlgarlrrg| SEG 164->177|apgpagddglggrg| HM:PFM:NREP 1 HM:PFM:REP 69->119|PF08808|0.00069|17.6|51/170|RES| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 170-178| PSIPRED ccccccccccccccccccccccccEEEcccccccEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHcccccEEcccccccEEccccHHHHHHHHHHHHHHHHccccEEEEEHEEEEEEcccccccccEEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccc //