[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56537.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56537.1 GT:GENE BAD56537.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1843737..1844087 GB:FROM 1843737 GB:TO 1844087 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56537.1 LENGTH 116 SQ:AASEQ MGLLGRLRGAVSRGGGTGPRAEDARYLAEWVRTHTGVEGFVEPKTTVTDVTVVLVAADGEWTRRVVGEAGARRLASDLRIPVYDVAKTGYPQRMRDYDERRRIERRRALEDELRDL GT:EXON 1|1-116:0| SEG 45->55|ttvtdvtvvlv| SEG 93->115|rmrdyderrrierrraledelrd| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------111111-11------1---1------11111111--------1-----------111-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 10-21, 100-116| PSIPRED ccccHHHHccccccccccccHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEccccEEEEcccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcc //