[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56539.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->94 1su2A PDBj 4e-08 43.1 %
:BLT:PDB   55->84 1f3yA PDBj 1e-08 70.0 %
:RPS:PDB   57->148 3dkuF PDBj 2e-14 21.6 %
:RPS:SCOP  44->162 1x51A1  d.113.1.3 * 1e-13 12.4 %
:HMM:SCOP  13->162 1ryaA_ d.113.1.5 * 2.8e-28 29.7 %
:RPS:PFM   55->158 PF00293 * NUDIX 1e-09 37.8 %
:HMM:PFM   31->149 PF00293 * NUDIX 2.4e-17 25.6 117/135  
:BLT:SWISS 45->84 RPPH_HELAH 8e-05 48.6 %
:BLT:SWISS 58->146 ADPP_METJA 5e-10 38.1 %
:PROS 63->84|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56539.1 GT:GENE BAD56539.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1845666..1846184 GB:FROM 1845666 GB:TO 1846184 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56539.1 LENGTH 172 SQ:AASEQ MQVAGVRGRPRWARLERVTETTAGVAQRQRVAAYAVCVRAGRVLLARWVPLDGSPPRWTMPGGGIDHGEDPYDAVIREVREETGYEFRPTRLLGMDSLRLTDDDGAAFHGLRVVYTGEIVGGELRYEVGGSTDRAEWFDLDAVTELDRVGLVDIALALYRDRPATGSLTASV GT:EXON 1|1-172:0| BL:SWS:NREP 2 BL:SWS:REP 45->84|RPPH_HELAH|8e-05|48.6|37/157| BL:SWS:REP 58->146|ADPP_METJA|5e-10|38.1|84/169| PROS 63->84|PS00893|NUDIX_BOX|PDOC00695| SEG 23->43|agvaqrqrvaayavcvragrv| BL:PDB:NREP 2 BL:PDB:REP 44->94|1su2A|4e-08|43.1|51/159| BL:PDB:REP 55->84|1f3yA|1e-08|70.0|30/165| RP:PDB:NREP 1 RP:PDB:REP 57->148|3dkuF|2e-14|21.6|88/149| RP:PFM:NREP 1 RP:PFM:REP 55->158|PF00293|1e-09|37.8|98/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 31->149|PF00293|2.4e-17|25.6|117/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 44->162|1x51A1|1e-13|12.4|113/142|d.113.1.3| HM:SCP:REP 13->162|1ryaA_|2.8e-28|29.7|148/160|d.113.1.5|1/1|Nudix| OP:NHOMO 27 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1------111-1---11--111--221-1-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------1-----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------ ---------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 70.3 SQ:SECSTR ###########################################EEEEEEccccccEEEEccEEEccTTccHHHHHHHHHHHHHcccccccEEEEEEEEEcTTccTTcEEEEEEEEEEEcccccccccccTTccEEEEEcHHHHHTccccccHHHHHHHHHHHcc######## DISOP:02AL 1-4, 167-172| PSIPRED ccccccccccHHHHHHHHHHHHccccccccEEEEEEEEEccEEEEEEEccccccccEEEcccccccccccHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccccccHHEEEEccHHHHcccccccHHHHHHHHHHHccccccccccc //