[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56543.1
DDBJ      :             putative branched-chain amino acid aminotransferase
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  685/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:366 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->366 3dtgA PDBj e-139 75.2 %
:RPS:PDB   6->366 3dtgA PDBj e-131 66.2 %
:RPS:SCOP  1->366 1ekfA  e.17.1.1 * 3e-83 32.8 %
:HMM:SCOP  1->364 1ekfA_ e.17.1.1 * 7.3e-113 41.9 %
:RPS:PFM   115->321 PF01063 * Aminotran_4 2e-30 48.1 %
:HMM:PFM   92->345 PF01063 * Aminotran_4 6.3e-28 27.1 221/232  
:BLT:SWISS 18->366 ILVE_MYCTU e-132 71.6 %
:PROS 239->272|PS00770|AA_TRANSFER_CLASS_4
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56543.1 GT:GENE BAD56543.1 GT:PRODUCT putative branched-chain amino acid aminotransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1848993..1850093 GB:FROM 1848993 GB:TO 1850093 GB:DIRECTION + GB:PRODUCT putative branched-chain amino acid aminotransferase GB:PROTEIN_ID BAD56543.1 LENGTH 366 SQ:AASEQ MTVAAQFARIPHPAPLPAQRVAEILAAPGFGRYFTDHMVSIEYTEAQGWSNAKVEPYGPLQMDPATMVFHYGQAIFEGLKAYRQADGGVATFRIDANAARFRRSARRMAMAELPDELFVESVRQLLEVDERWVPAAGGEESLYLRPFMFATEAGLGVKPASAYTYLLLASPAGAYFPRGVKPVRVWLSTEYVRAAPGGTGEAKVAGNYAASLLAQAQAAEQGCDQVVWLDACERRYVEEMGTNNLFFVYGSGSQARLVTPELSGSLLPGITRDSLLTLAADAGYPVEERKISVEEWRTGAQSGEITEVFACGTAAVITPVGWVRSAEGEFTIGGGEPGEVTMALRETLTGIQRGTFADIHGWMRRL GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 18->366|ILVE_MYCTU|e-132|71.6|348/368| PROS 239->272|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| SEG 98->111|aarfrrsarrmama| SEG 209->219|aasllaqaqaa| BL:PDB:NREP 1 BL:PDB:REP 24->366|3dtgA|e-139|75.2|343/363| RP:PDB:NREP 1 RP:PDB:REP 6->366|3dtgA|e-131|66.2|361/363| RP:PFM:NREP 1 RP:PFM:REP 115->321|PF01063|2e-30|48.1|185/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 92->345|PF01063|6.3e-28|27.1|221/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 1->366|1ekfA|3e-83|32.8|354/365|e.17.1.1| HM:SCP:REP 1->364|1ekfA_|7.3e-113|41.9|360/365|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1269 OP:NHOMOORG 892 OP:PATTERN ------------------111--1111-1-11111------------------------------112 1111111111111111111-111111111111111121211111111111111111111112112112111111111111111-111111111111-1111111121112---------------111111111111112211112211111111111111111111---111111111111111111-----2---------------111112-------111111111111111111111111111111111-11112-1-11--11-1-11111111111111111111111111111111111111111111111111-1111----1--1111-1111111-1-11111----1-------------11-111211111--11211111111----------1---1--1-1----1--111111111--1-1---------211111111-1111-1-------------------------------1111111111222122211111111222212112211111223111111111111111111111111111-1112211111111112111111111111132121121-11-1111111111111111111-111111111111111111111211112122122---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111111111-1111111111111111111111111111111111111111-111111-111111111111111111111111111111-111111----------1-------------------------------------- ----111-21212223453633556542222122323332222222433643954333333321111122211122212212222211-23342422222313334-27122421442222121932624O2-3351222522211211121111112222111112111722312222H2222265648844421213 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 366 STR:RPRED 100.0 SQ:SECSTR GGcEEccEEccccccccHHHHHHHHHccccccccccEEEEEEEETTTEEEEEEEEEcccccccTTcTHHHHccEEEccEEEEEcTTccEEEEcHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHGGGccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEccccTTccccEEEEEccccccccTTccTTcccHHHHHHHHHHHHHHHHTTccEEEEEcTTTcccEEEETTEEEEEEEccGGGcEEEEccccccccccHHHHHHHHHHHHHTcEEEEccccHHHHHHHHHHTcEEEEEEEETTTEEEEEEEEEETTEEEEcTTccccHHHHHHHHHHHHHHTTccccTTccEEEc DISOP:02AL 1-2, 7-22| PSIPRED ccEEEEEccccccccccccHHcccccccccccEEccEEEEEEEccccEEEccEEEcccccEEcHHHHHHHcccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccccccccccccEEEEEEEEcccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEEccEEEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEEEcccEEEEEEEEEEccccEEEccccccHHHHHHHHHHHHHHHccccccccccEEEc //