[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56544.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  735/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->222 2qedA PDBj 1e-18 38.2 %
:RPS:PDB   31->205 2bc2B PDBj 2e-18 16.7 %
:RPS:SCOP  22->207 1qh3A  d.157.1.2 * 9e-25 34.3 %
:HMM:SCOP  6->224 1qh5A_ d.157.1.2 * 3e-47 38.7 %
:RPS:PFM   61->175 PF00753 * Lactamase_B 5e-06 36.8 %
:HMM:PFM   29->203 PF00753 * Lactamase_B 8.8e-22 19.2 172/194  
:BLT:SWISS 23->229 GLO2_RHORT 1e-22 37.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56544.1 GT:GENE BAD56544.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1850140..1850853) GB:FROM 1850140 GB:TO 1850853 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56544.1 LENGTH 237 SQ:AASEQ MSSDRLYFRQLLSGRDFAVGDPIATQMRNFAYLIGDRETGDCVVVDPAYAAGDLVDIAEADGLRLTGVLATHHHPDHVGGTMLGFTLRGVAELLEKTSVPVHVNARELSWVADVTGIAPSELTGHEHGDTVAVGAMTIELLHTPGHTPGSQCFLFEDRLIAGDTLFVDGCGRTDFPGGDSDEMFRSLRYLAGLSGDPVVYPGHWYSEEPSAALSTVRNNNYVMRPQTLEQWHMLMPG GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 23->229|GLO2_RHORT|1e-22|37.2|188/256| BL:PDB:NREP 1 BL:PDB:REP 29->222|2qedA|1e-18|38.2|173/252| RP:PDB:NREP 1 RP:PDB:REP 31->205|2bc2B|2e-18|16.7|162/215| RP:PFM:NREP 1 RP:PFM:REP 61->175|PF00753|5e-06|36.8|106/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 29->203|PF00753|8.8e-22|19.2|172/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 22->207|1qh3A|9e-25|34.3|166/260|d.157.1.2| HM:SCP:REP 6->224|1qh5A_|3e-47|38.7|186/260|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 1931 OP:NHOMOORG 961 OP:PATTERN 11----1122222222--1111122A62-133-1-11-1111112-212111-11111111---1-11 2122221344421242244-44332444444264451486-2322-12----321222--3221447-233-------1113411111111111221--2-113242222--------------2111111111-1122211112-32-21112222-111-1122111211-1-111-1--112222--123522222322122222211332323224222321--1-121233312322322323122111----------------------1111111111-1111111111111111-111111111-1111-1111121121111111111212211111111112111111111121111111-1213333312221223446433324222222222223-36336352443223334334323434332221-11-3122222222213322222-----------------------------2336122221113323132222112411111211434441333333322324121233441232111111122234224331111212111111111122222215344111-----------------1-111441124522222222222141211232112322-144221--11121222122222222222-2222222222222222222222221222222222222222222222222222-222222222222221222222111133322222112111111222444443234242323332232333332222222222222222122222222121111211-1-2212223122------------1-1--------------------------1----1---11- 1---122-2--2234112222233333111111-11111111111-21212112121-13221111111111111221-211111111-2111221112121-332-142644233-111-1214312-4F3-213-31-3-22-122-1111132-136832533-1232212311-3N2211163672941321113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 97.5 SQ:SECSTR ####cEEEEEEEEETTEEEEEEEccccEEEEEEEEETTEEcEEEEccHHHHHHHHHHHHHHTccEEEEEcccccHHHHTTHHHHGGGcTTHHHHHHTTcEEEccHHHHHHHHHTTcccccccccccEEEEEETTEEEEEEcccccccccccEEEETTTEEEETcccTTcccccccTTccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccEEEEccTcc## DISOP:02AL 1-3| PSIPRED ccccHHEEEEEEcccEEEEEcccccccccEEEEEEEccccEEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccHHHHHHcccEEEEcHHHHHHHccccccccccEEEEccccEEEEccEEEEEEEEcccccccEEEEEccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHcc //