[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56548.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  368/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1c.23.16
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   111->187 3graA PDBj 6e-05 32.4 %
:BLT:PDB   213->314 1ti9A PDBj 1e-07 25.5 %
:RPS:PDB   33->226 3bhnA PDBj 2e-21 17.3 %
:RPS:PDB   213->320 1bl0A PDBj 9e-23 24.1 %
:RPS:SCOP  4->193 1j42A  c.23.16.2 * 5e-13 15.5 %
:RPS:SCOP  168->318 1v4aA1  a.24.16.4 * 3e-20 16.2 %
:HMM:SCOP  1->194 1pe0A_ c.23.16.2 * 7e-46 38.0 %
:HMM:SCOP  213->264 1d5yA1 a.4.1.8 * 1.8e-08 32.7 %
:HMM:SCOP  267->317 1d5yA2 a.4.1.8 * 4.6e-11 37.3 %
:RPS:PFM   110->175 PF01965 * DJ-1_PfpI 2e-09 49.2 %
:RPS:PFM   276->314 PF00165 * HTH_AraC 3e-05 41.0 %
:HMM:PFM   226->265 PF00165 * HTH_AraC 4e-08 27.5 40/42  
:HMM:PFM   277->315 PF00165 * HTH_AraC 1.3e-10 34.2 38/42  
:HMM:PFM   46->176 PF01965 * DJ-1_PfpI 9.7e-18 29.2 130/148  
:BLT:SWISS 113->318 GLXA_RHIME 6e-14 29.6 %
:PROS 268->310|PS00041|HTH_ARAC_FAMILY_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56548.1 GT:GENE BAD56548.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1853537..1854505) GB:FROM 1853537 GB:TO 1854505 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56548.1 LENGTH 322 SQ:AASEQ MLSKVAVPLFEKLAMFEFGVVCEVFGLDRTADGLPGFDFKVCGAEPGKPLRSTTPGVTVTPEYDLAELARADLVAVPAAPVSALTGDLDPQLVEAVRAAADAGATVLTVCSGAFVAGAAGLLDGRKCTTHWRYVDQLAARYPKATVDPDVLFVDEGDLITSAGTAAGIDACLHLVRREIGSAAANGIARRMVVPPQRDGGQRQFIERPVADCEADSLGETLLWMSEHLELPHTVESLAARASMSTRTFARRFAAETGTTPVKWLTNQRVLRAEHLLEETDLGLEQIAARCGFGSGALLRHHFQRQVGIAPTEYRRRFGRRPS GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 113->318|GLXA_RHIME|6e-14|29.6|199/324| PROS 268->310|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| SEG 68->84|laradlvavpaapvsal| SEG 93->109|veavraaadagatvltv| BL:PDB:NREP 2 BL:PDB:REP 111->187|3graA|6e-05|32.4|74/180| BL:PDB:REP 213->314|1ti9A|1e-07|25.5|102/129| RP:PDB:NREP 2 RP:PDB:REP 33->226|3bhnA|2e-21|17.3|185/208| RP:PDB:REP 213->320|1bl0A|9e-23|24.1|108/116| RP:PFM:NREP 2 RP:PFM:REP 110->175|PF01965|2e-09|49.2|63/135|DJ-1_PfpI| RP:PFM:REP 276->314|PF00165|3e-05|41.0|39/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 226->265|PF00165|4e-08|27.5|40/42|HTH_AraC| HM:PFM:REP 277->315|PF00165|1.3e-10|34.2|38/42|HTH_AraC| HM:PFM:REP 46->176|PF01965|9.7e-18|29.2|130/148|DJ-1_PfpI| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 4->193|1j42A|5e-13|15.5|181/185|c.23.16.2| RP:SCP:REP 168->318|1v4aA1|3e-20|16.2|148/151|a.24.16.4| HM:SCP:REP 1->194|1pe0A_|7e-46|38.0|184/187|c.23.16.2|1/1|Class I glutamine amidotransferase-like| HM:SCP:REP 213->264|1d5yA1|1.8e-08|32.7|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 267->317|1d5yA2|4.6e-11|37.3|51/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 1450 OP:NHOMOORG 373 OP:PATTERN ------------------------------1------------------------------------- 111-B--1--1---61111-15--1711111153337596-319361-----211-----521-6-CEC9----------1--------1---2--1----1---A23-7--------------------------12111---1-21-1--------------1-2----------------1-------------------------2---1---1-311--1------48---------------------------1---------------------------------------------------------------1--------------1--------1----1--21---------------3-48334-----23444---31-2-2211211-215-663466376A2-766475CFB8AF83-14347312257B--------41212--1--------------------------------2--12125DKKIKFA9997FFOPCDDC4CKHL5D84--5551-321412264181-11152-------2-1-31-2---1--111--2-112---2------34---------------------------111121124-51-21111--1311-2122--1------2------1333-611331111111-31121111213111111117B51222-2122222222112122411211111-2--------------1----------2845---2-1---------11121-2-123199997AEF8BDBE4876-------------322212121232222121----------------------------------------------------------------2- -----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 99.7 SQ:SECSTR cccEEEEEEcTTccHHHHHHHHHHHHHTTcHTTTccccEEEEEEEcccEEEcTTTTcEEEccEEGGGGGGccEEEEcccTTHHHHHHHHTcHHHHHccccTTTcEEEEETTHHHHHHHTTTTTTcEEcccGGGHHHHHHTcEcEEcEccccEEEETTEEEEccGGGHHHHHHHHHHHHccHHHHHHHHTTTccTTcHHHHHHHHHHHHHHHTcHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccccc# DISOP:02AL 318-322| PSIPRED ccEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEccccEEEEccccHHHcccccEEEEcccccccHHccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccccEEEEcHHHHHHHHHHccccccccccEEEEcccEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHccccc //