[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56549.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56549.1 GT:GENE BAD56549.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1854597..1854758 GB:FROM 1854597 GB:TO 1854758 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56549.1 LENGTH 53 SQ:AASEQ MTALILTLAALGFLGLLLALGHGLSGSSPVVDRDAQRVRAELDAIAGRLTHHR GT:EXON 1|1-53:0| TM:NTM 1 TM:REGION 5->27| SEG 3->24|aliltlaalgflglllalghgl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-53| PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccc //