[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56551.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  583/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->116 2apnA PDBj 2e-21 43.8 %
:RPS:PDB   28->116 2apnA PDBj 6e-28 43.8 %
:RPS:SCOP  28->103 1nwbA  b.124.1.1 * 2e-20 42.1 %
:HMM:SCOP  3->103 1nwbA_ b.124.1.1 * 2e-28 39.6 %
:RPS:PFM   28->103 PF01521 * Fe-S_biosyn 4e-11 38.2 %
:HMM:PFM   12->103 PF01521 * Fe-S_biosyn 2.1e-29 41.8 91/91  
:BLT:SWISS 1->116 Y2227_MYCBO 1e-48 79.3 %
:PROS 98->115|PS01152|HESB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56551.1 GT:GENE BAD56551.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1855666..1856016 GB:FROM 1855666 GB:TO 1856016 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56551.1 LENGTH 116 SQ:AASEQ MTVQNETTTHGVTLTDAAAAKAKALLDQEGRDDLALRIAVQPGGCAGLRYQLFFDDRSLDGDLTADFGGVTLAVDRMSAPYVQGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 1->116|Y2227_MYCBO|1e-48|79.3|116/118| PROS 98->115|PS01152|HESB|PDOC00887| SEG 13->27|tltdaaaakakalld| BL:PDB:NREP 1 BL:PDB:REP 28->116|2apnA|2e-21|43.8|89/114| RP:PDB:NREP 1 RP:PDB:REP 28->116|2apnA|6e-28|43.8|89/114| RP:PFM:NREP 1 RP:PFM:REP 28->103|PF01521|4e-11|38.2|76/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 12->103|PF01521|2.1e-29|41.8|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 28->103|1nwbA|2e-20|42.1|76/101|b.124.1.1| HM:SCP:REP 3->103|1nwbA_|2e-28|39.6|101/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1081 OP:NHOMOORG 676 OP:PATTERN ------------------------1--11-11------------------11--------------11 1111111111111111111-111111111111111111111222111111111111111111111111111-----------112111-----------1-111111112--------------1---------1-11111---11223333111111--11-12124333--1-111-1-1111111---11-1111111111111111-----111-1-1--1------211--------------11111--------------------------------------------------------------------------------------------------1---------------------1-1111111111322221122222222222222221-2222232212121222222221222212121222222222222222213312231-1111-----2221221222222221-1-11-113222212222221111122222111112442222222223222224221222322222222222221212331-----------------------111122---------------------------332221212122222222222222222112221--22121--11112222221111111111-1111111111111111111222222221111111111111111311111112-2222222222222112111112222421222222222222222222222222222312222222222222222211111111122222222222222211222222221111223-----------------------------------------------------42- ------1-----111------------------------------------------------1-----------------1111-1---2-----------1222-121111112--111-2111-1-131-1-11--11-111-1---1--212-221-12111-1132-1112332S111127545-331-2122- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 76.7 SQ:SECSTR ###########################HHTccccEEEEcccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHcccccccccc DISOP:02AL 1-7, 114-116| PSIPRED ccccccccccccEEcHHHHHHHHHHHHcccccccEEEEEEEccccccEEEEEEEccccccccEEEEcccEEEEEcHHHHHHHcccEEEEEEcccccEEEEEccccccccccccccc //