[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56554.1
DDBJ      :             putative cytochrome c oxidase subunit II
Swiss-Prot:COX2_NOCFA   RecName: Full=Probable cytochrome c oxidase subunit 2;         EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide II;AltName: Full=Cytochrome aa3 subunit 2;

Homologs  Archaea  0/68 : Bacteria  337/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.6.1f.17.2
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->338 1m56B PDBj 4e-16 26.0 %
:RPS:PDB   162->334 3dtuB PDBj 4e-21 28.4 %
:RPS:SCOP  245->362 1cywA  b.6.1.2 * 2e-16 15.2 %
:HMM:SCOP  41->148 1ar1B2 f.17.2.1 * 2.8e-18 24.8 %
:HMM:SCOP  146->341 1fftB1 b.6.1.2 * 6.2e-37 36.5 %
:RPS:PFM   245->316 PF00116 * COX2 7e-09 39.4 %
:HMM:PFM   245->322 PF00116 * COX2 1.2e-15 33.3 72/120  
:HMM:PFM   37->135 PF00033 * Cytochrom_B_N 0.00011 17.2 93/188  
:BLT:SWISS 1->375 COX2_NOCFA 0.0 100.0 %
:PROS 262->316|PS00078|COX2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56554.1 GT:GENE BAD56554.1 GT:PRODUCT putative cytochrome c oxidase subunit II GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1859406..1860533 GB:FROM 1859406 GB:TO 1860533 GB:DIRECTION + GB:PRODUCT putative cytochrome c oxidase subunit II GB:PROTEIN_ID BAD56554.1 LENGTH 375 SQ:AASEQ MCGDQEGVSVAHKASEEIGARPVRGRQGRILRRAGLAVSLGITAMLVSGCSIDNVWLRFGWPSGVTPQATRMRELWTWSIIAALAMGVLVWGLTFWTVVFHRKKKDSPEFPRQTGYNVPLELTYTAIPFVIIAVLFYFTVVVQNYVHEKVADPDVTVDVTAFQWNWKFGYREVDFKDGGYQFNGIDTAREEAAQAQLKEYEERVDTEHGHPQPGPVHGKPENDILSYLHYDTVETVGTSTEIPVLVLPTGKVIEFQLAAADVIHAFWVPEFLFKRDVMPNPKENHSDNVFQITEIEKEGAFVGRCAEMCGTYHSMMNFEVRAVSPEKFTRYLDERRAGKTNAEALAAIGESPVATSTRPFNTDRTVKSAAAPEAE GT:EXON 1|1-375:0| SW:ID COX2_NOCFA SW:DE RecName: Full=Probable cytochrome c oxidase subunit 2; EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide II;AltName: Full=Cytochrome aa3 subunit 2; SW:GN Name=ctaC; OrderedLocusNames=NFA_17080; SW:KW Cell membrane; Complete proteome; Copper; Electron transport;Membrane; Metal-binding; Oxidoreductase; Respiratory chain;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->375|COX2_NOCFA|0.0|100.0|375/375| GO:SWS:NREP 9 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0070469|"GO:respiratory chain"|Respiratory chain| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 262->316|PS00078|COX2|PDOC00075| TM:NTM 3 TM:REGION 34->56| TM:REGION 77->99| TM:REGION 124->146| SEG 150->161|vadpdvtvdvta| BL:PDB:NREP 1 BL:PDB:REP 60->338|1m56B|4e-16|26.0|242/260| RP:PDB:NREP 1 RP:PDB:REP 162->334|3dtuB|4e-21|28.4|141/259| RP:PFM:NREP 1 RP:PFM:REP 245->316|PF00116|7e-09|39.4|66/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 245->322|PF00116|1.2e-15|33.3|72/120|COX2| HM:PFM:REP 37->135|PF00033|0.00011|17.2|93/188|Cytochrom_B_N| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 1 RP:SCP:REP 245->362|1cywA|2e-16|15.2|112/159|b.6.1.2| HM:SCP:REP 41->148|1ar1B2|2.8e-18|24.8|105/107|f.17.2.1|1/1|Cytochrome c oxidase subunit II-like, transmembrane region| HM:SCP:REP 146->341|1fftB1|6.2e-37|36.5|126/166|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 383 OP:NHOMOORG 348 OP:PATTERN -------------------------------------------------------------------- --11111111111111111-111111111111111111111111111111111111111111111111111-------------------------------------1------------------------------11---1-1--2---1111--11-11-122221-111---1-1--11-11----1-111111111111111111111111111-111------111---------------------------------------------------------------------------------------------------------------------1---------------------1-1---2------1111111-11211111111-111-1132131221-----122111232-111-11--1--11-------------112-111-----1111111111111111-1111--1-------11111111----111111111--1212111111111111111121--1-11-1--------113321-----------11----1----------11--------------------------------211111111111111111111111111---21-1--------------------------------------------------------------------------------------------1-----1111111---------------------------21----1111211112----------------1-----111111111111111--------111111-----------------------------------------------1- 11------1-----------------------------------------------------1--11---------1--------------------1------1-----------------------------------------------------------------------1--------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 83.2 SQ:SECSTR ###########################################################cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTTcTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcGGGGGccccccccccEETTEEEEEETTTTEEEEEccTTcGGGEEETccccccHHHHHHHHHccccTTccGGGTTTccccTcEEccEEEEcTTcEEEEEcEEEETTcEEEEEEEEccccEEEEEGGGTEEEEEccTccETTccEEEEEEEccccEEEEEcccccccTTGGGccEEEEEEcHHHHHHHHHHHHccccccHHHHHHHHccccccccEEEc##cccTTHHHH## DISOP:02AL 1-6, 15-33, 334-348, 367-375| PSIPRED cccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEcccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEEEEccccccccccEEEEcccccHHHHHccccccccccccccccccccccccEEcccccccccccccccccccccccccEEEEEccccEEEEEEEccHHHHHHHHHHccEEccccccccHHHHHHEEEEEEccccEEEEEEHHHcccccccccEEEEEEcHHHHHHHHHHHHcccccccHHHHHccccccccccccccccccccccccccc //