[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56555.1
DDBJ      :             hypothetical protein
Swiss-Prot:COX4_NOCFA   RecName: Full=Probable cytochrome c oxidase polypeptide 4;         EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide IV;AltName: Full=Cytochrome aa3 subunit 4;

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->138 PF12270 * Cyt_c_ox_IV 1e-21 49.0 %
:HMM:PFM   1->138 PF12270 * Cyt_c_ox_IV 1.2e-58 58.4 137/137  
:BLT:SWISS 1->138 COX4_NOCFA 6e-48 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56555.1 GT:GENE BAD56555.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1860547..1860963 GB:FROM 1860547 GB:TO 1860963 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56555.1 LENGTH 138 SQ:AASEQ MRIEARIFELLTVFFIIVGVVYGFFTAQSRTGVEWAGTTAIVLTAGLSLIIGTYFRFVARRLDLRPEDYEDAEIVDGAGDLGFFSPGSFWPILLAGAGSVAALGLAFFEPWLIAVGVICVIAAAAGLVFEYHLGPEKH GT:EXON 1|1-138:0| SW:ID COX4_NOCFA SW:DE RecName: Full=Probable cytochrome c oxidase polypeptide 4; EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide IV;AltName: Full=Cytochrome aa3 subunit 4; SW:GN Name=ctaF; OrderedLocusNames=NFA_17090; SW:KW Cell membrane; Complete proteome; Membrane; Oxidoreductase;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|COX4_NOCFA|6e-48|100.0|138/138| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 5->27| TM:REGION 35->57| TM:REGION 87->109| TM:REGION 113->135| SEG 13->25|vffiivgvvygff| SEG 93->106|llagagsvaalgla| SEG 112->128|liavgvicviaaaaglv| RP:PFM:NREP 1 RP:PFM:REP 34->138|PF12270|1e-21|49.0|104/134|Cyt_c_ox_IV| HM:PFM:NREP 1 HM:PFM:REP 1->138|PF12270|1.2e-58|58.4|137/137|Cyt_c_ox_IV| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ----1--11111--11111-11111111111111111111---1----11-------1--11111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 136-138| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccc //