[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56556.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.145.1
:438 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->109 2vfuA PDBj 6e-05 34.4 %
:RPS:PDB   48->220 3d2hA PDBj 1e-12 15.1 %
:RPS:SCOP  46->167 1i19A2  d.145.1.1 * 3e-13 18.9 %
:HMM:SCOP  25->189 1w1oA2 d.145.1.1 * 1.9e-34 33.9 %
:RPS:PFM   67->158 PF01565 * FAD_binding_4 4e-08 35.9 %
:HMM:PFM   26->158 PF01565 * FAD_binding_4 4.9e-26 32.1 131/138  
:BLT:SWISS 45->166 GGLO_PIG 3e-09 27.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56556.1 GT:GENE BAD56556.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1861272..1862588) GB:FROM 1861272 GB:TO 1862588 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56556.1 LENGTH 438 SQ:AASEQ MRTSGSAVVKFPAMSTPQTVSAEEYLPRDTADVVRTVRDSRVRAERLTVRGGEAFEDSLLVPDHRAVVSLRRMNAVLDINLGRRTVRVQAGAKLSDIDRRLGAHGLGLPIVGDHRDITAGGFASVGGVSSASHRYGLFIDQIVDLEYVDPDGRIGTCGRNHHTERFHRILGAGGRAGIITALTLDTVEVDKDHTWLTTDADRFLDFDSFVEHAHAEIVRPGNAVLQVGRWVDTAPLKVARPVGTGHVQLGTVRFGQWSSLYPTTPTRSLRARREVGTRTRKSLGAIASHAGGRAGMPVRNAAAGALMFAPKVLTLRDAEYLADTVISSSERGPAYRVGVFAPMSTYASVFYRLHDLFAGHRERTGCFTVISAMTYGVRSKYLRAEASARNLPVEDHGLITFTCRLRPSALPSELLRDIVAGIDEICASEHAMRYESAQ GT:EXON 1|1-438:0| BL:SWS:NREP 1 BL:SWS:REP 45->166|GGLO_PIG|3e-09|27.5|120/440| SEG 28->44|rdtadvvrtvrdsrvra| SEG 119->132|aggfasvggvssas| SEG 168->183|rilgaggragiitalt| BL:PDB:NREP 1 BL:PDB:REP 46->109|2vfuA|6e-05|34.4|64/414| RP:PDB:NREP 1 RP:PDB:REP 48->220|3d2hA|1e-12|15.1|172/498| RP:PFM:NREP 1 RP:PFM:REP 67->158|PF01565|4e-08|35.9|92/139|FAD_binding_4| HM:PFM:NREP 1 HM:PFM:REP 26->158|PF01565|4.9e-26|32.1|131/138|FAD_binding_4| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| RP:SCP:NREP 1 RP:SCP:REP 46->167|1i19A2|3e-13|18.9|122/217|d.145.1.1| HM:SCP:REP 25->189|1w1oA2|1.9e-34|33.9|165/206|d.145.1.1|1/1|FAD-binding domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 329 STR:RPRED 75.1 SQ:SECSTR #############################################cEEEEcccTTcTTTcccccEEEEEcTTcccEcEEETTTTEEEEETTccHHHHHHHHHHHcccEEccccccTTccHHHHHHTccccTTHHHccGGGGEEEEEEEcTTccEEcHHHHcHHHHHHHTTccTTcccEEEEEEEEcEEccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHccTTEcEEEEEEEEETTEEEEEEEEEEcccHHHHHHHHHHTTccEEEEEEEEEcHHHHHTTccTTccccccccccccccEEEEEEEEc#cccHHHHHHHHHHHHHcccccTTEEEEEEEEEcccTTcTGGGccTTTcccccTTccEEEEEEEEET############################################################### DISOP:02AL 1-3, 435-438| PSIPRED ccccccEEEEEcccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEHHHcccEEEEEccccEEEEEccccHHHHHHHHHHccccccccccccccccHHHHHccccccccccccHHHHHHEEEEEEEccccEEEEcccccHHHHHHHHHccccEEEEEEEEEEEEEcccEEEEEEEEHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEccHHHHcccccccHHHEEEcccccccccccccccccccccccHHHHcccccEEEEHHHHHHHHHcccccccccccHHHccccccccHHHHHHHHHccHHcccccEEEEEEccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccc //