Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56560.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56560.1 GT:GENE BAD56560.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1865472..1865906) GB:FROM 1865472 GB:TO 1865906 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56560.1 LENGTH 144 SQ:AASEQ MSSESHGRDARSGGQPDSFAEFAEELRLLAETVLERVEPVLRRSAAEGQPEWSSCSWCPVCAAAALVRGEHHDVLAAIADHGTAIVTVLREALAGAPVEPVLPTETDPETGARHEHAPRTGESARRGAAGTRPGYVDIPVTVRS GT:EXON 1|1-144:0| SEG 19->31|faefaeelrllae| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------1--------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 105-129| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcc //