[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56563.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->119 1x53A1 d.129.3.5 * 5.3e-05 30.3 %
:HMM:PFM   5->58 PF10604 * Polyketide_cyc2 1.3e-07 28.3 53/139  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56563.1 GT:GENE BAD56563.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1867776..1868159) GB:FROM 1867776 GB:TO 1868159 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56563.1 LENGTH 127 SQ:AASEQ MSSIQVADQTFIAAPGAAVAEVLADRGRWRRWWPDLMLEVREDRGDKGIRWLVRGPLTGTMEVWLEPSLDGVILHYFLHCEPEGAPALPPRKLAALNRARRVAGKVMSFEVKALLEAGRPAGVTPAA GT:EXON 1|1-127:0| SEG 13->24|aapgaavaevla| SEG 85->103|apalpprklaalnrarrva| HM:PFM:NREP 1 HM:PFM:REP 5->58|PF10604|1.3e-07|28.3|53/139|Polyketide_cyc2| HM:SCP:REP 1->119|1x53A1|5.3e-05|30.3|109/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 124-127| PSIPRED cccEEccccEEEEccHHHHHHHHHHccccccccccEEEEEEEccccccEEEEEEEccEEEEEEEEccccccEEEEHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //