[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56566.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  517/915 : Eukaryota  3/199 : Viruses  2/175   --->[See Alignment]
d.3.1
:354 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   258->332 2hbwA PDBj 2e-12 43.2 %
:RPS:SCOP  242->354 2evrA2  d.3.1.16 * 1e-28 29.2 %
:HMM:SCOP  231->354 2evrA2 d.3.1.16 * 3.7e-41 44.4 %
:RPS:PFM   255->353 PF00877 * NLPC_P60 2e-25 58.3 %
:HMM:PFM   255->345 PF00877 * NLPC_P60 1.2e-27 50.6 89/105  
:HMM:PFM   41->66 PF07741 * BRF1 0.00053 42.3 26/97  
:BLT:SWISS 103->354 Y2213_MYCBO 5e-35 52.9 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56566.1 GT:GENE BAD56566.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1870401..1871465) GB:FROM 1870401 GB:TO 1871465 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56566.1 LENGTH 354 SQ:AASEQ MVADHRPHRTRRLLGGILVAGVLATGVCASGPAIADPVALPATASEAVQRMIELSRQSEQLNQQALGAQADLDAKLAAQQAAEAELATRTAAVEAARAEVRRFQPVIDRTAIAAYQGARTNRMFAVLVSDSPQQLLDQMSTLDVLSAQTSEELRRFKKADDAAVAAESAARAAADTARAAAAEAERVRADLERKRSELGGAIAQVVQAWGALSTRDKSALAGSPFPPGFDRDTLLQGLVPGSGTSALAAGLTRVGDPYVWGATGPHQFDCSGLVQWAFKQVGKDVPRTSSAQASYGTPVAKEDLQPGDVVFFYPDISHVGIYAGNGLMLHASTFGVPVAVAPMDSTPYHSARRY GT:EXON 1|1-354:0| BL:SWS:NREP 1 BL:SWS:REP 103->354|Y2213_MYCBO|5e-35|52.9|240/385| COIL:NAA 107 COIL:NSEG 2 COIL:REGION 48->102| COIL:REGION 157->208| SEG 13->27|llggilvagvlatgv| SEG 64->102|qalgaqadldaklaaqqaaeaelatrtaaveaaraevrr| SEG 159->190|addaavaaesaaraaadtaraaaaeaervrad| BL:PDB:NREP 1 BL:PDB:REP 258->332|2hbwA|2e-12|43.2|74/218| RP:PFM:NREP 1 RP:PFM:REP 255->353|PF00877|2e-25|58.3|96/100|NLPC_P60| HM:PFM:NREP 2 HM:PFM:REP 255->345|PF00877|1.2e-27|50.6|89/105|NLPC_P60| HM:PFM:REP 41->66|PF07741|0.00053|42.3|26/97|BRF1| RP:SCP:NREP 1 RP:SCP:REP 242->354|2evrA2|1e-28|29.2|113/148|d.3.1.16| HM:SCP:REP 231->354|2evrA2|3.7e-41|44.4|124/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 1228 OP:NHOMOORG 523 OP:PATTERN -------------------------------------------------------------1------ -112944444434334433-3H334544444497BC468C545E42314212-32111224332653ACA61---111-2621-2111--1--------------13-----------------1222221-12-111111---41-11-111----------1-11111--1-----111--22211---32323344323433345332333333343443225334356221----------1-------3444223-121542222312---1111------------111-11-1--------1-----11---2-1-1215633345643525C22122232133-161164-211--121111--31111------------------------------------------------11------1-----11--------------------------------------------------------1-122222222222222222222222222222222212222111222112211111111122222222-11111------1-2312221333222212------211----1111---1-------1---42222--------1-11111111111-111111--2---1------23232323333322133-3333323333323333333222112211111111111111111212312232-333333333333---1---------1112-222111122211--1----------2-33333334333332233-----------11-1111111---22212112222222------------------1---------------------------------1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-----1---- --------------1-----------------------------------------------------------------------------------------------1---------------------------------------------------------------- STR:NPRED 101 STR:RPRED 28.5 SQ:SECSTR #############################################################################################################################################################################################################################################################TTccccTTccccccccHHHHHHHHHHTTTccccccHHHHHHHcEEEcGGGccTTcEEEEEcccEEEEEEEETTEEEEEETTEEEEEEcHHHHHHEEEEEEc DISOP:02AL 1-11, 180-201, 214-244| PSIPRED cccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHccccccccHHHHHHHcccccHHHcccccEEEEcccccEEEEEEcccEEEEEccccccEEEEEccccccccEEcc //