[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56569.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:91 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->80 2djwA PDBj 2e-15 46.2 %
:RPS:PDB   1->78 2djwH PDBj 2e-14 46.2 %
:RPS:SCOP  2->78 1i1gA2  d.58.4.2 * 7e-14 23.4 %
:HMM:SCOP  1->79 1i1gA2 d.58.4.2 * 1.2e-16 34.2 %
:RPS:PFM   20->77 PF01037 * AsnC_trans_reg 6e-07 36.2 %
:HMM:PFM   6->76 PF01037 * AsnC_trans_reg 1.6e-19 31.0 71/74  
:BLT:SWISS 3->75 REG9_PYRFU 9e-07 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56569.1 GT:GENE BAD56569.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1874591..1874866 GB:FROM 1874591 GB:TO 1874866 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56569.1 LENGTH 91 SQ:AASEQ MITAIVLIHADNARIPETAQAVADTEGVAEVYSCAGDVDLIAIVRVRDHEQIAEVVTGRIDKTPGVQRTTTHIAFKSYSRADVEAGFSLGE GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 3->75|REG9_PYRFU|9e-07|34.2|73/150| BL:PDB:NREP 1 BL:PDB:REP 1->80|2djwA|2e-15|46.2|80/80| RP:PDB:NREP 1 RP:PDB:REP 1->78|2djwH|2e-14|46.2|78/79| RP:PFM:NREP 1 RP:PFM:REP 20->77|PF01037|6e-07|36.2|58/74|AsnC_trans_reg| HM:PFM:NREP 1 HM:PFM:REP 6->76|PF01037|1.6e-19|31.0|71/74|AsnC_trans_reg| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 1 RP:SCP:REP 2->78|1i1gA2|7e-14|23.4|77/80|d.58.4.2| HM:SCP:REP 1->79|1i1gA2|1.2e-16|34.2|79/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------11111---11111---111111--111-1111111-111-------1-------------------------1---------------------------11111---1--------------------------------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 87.9 SQ:SECSTR cEEEEEEEEEcTTTHHHHHHHHHTcTTEEEEEEccccccEEEEEEEcccTTHHHHTTTTGGGcTTEEEEEEEEccccccc########### PSIPRED cEEEEEEEEEccccHHHHHHHHHcccccEEEEEEcccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEEEEccHHHHHHHHcccc //