[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56571.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->145 PF06877 * DUF1260 8e-06 21.8 87/104  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56571.1 GT:GENE BAD56571.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1876158..1876619) GB:FROM 1876158 GB:TO 1876619 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56571.1 LENGTH 153 SQ:AASEQ MTGQDEENLRRGEDVAGRMWRRLFGRGGPAPLDPDRTDLVVLTESFDDAEACSAALARASGLDAATPAVLRHHLRVPAGQVERVCAIAAQDGYSPAAAPAGPGPDGLVPLRLHRVQPIDALHCSQERSRMAGLAQRHDGHADGWQVLAPAPPG GT:EXON 1|1-153:0| SEG 49->65|aeacsaalarasgldaa| SEG 95->104|paaapagpgp| HM:PFM:NREP 1 HM:PFM:REP 59->145|PF06877|8e-06|21.8|87/104|DUF1260| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 129-131, 152-153| PSIPRED cccccHHHHHcccHHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccc //