[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56572.1
DDBJ      :             putative cytochrome c oxidase subunit III
Swiss-Prot:COX3_NOCFA   RecName: Full=Probable cytochrome c oxidase subunit 3;         EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide III;AltName: Full=Cytochrome aa3 subunit 3;

Homologs  Archaea  22/68 : Bacteria  578/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
f.25.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->201 1v54C PDBj 9e-26 37.4 %
:RPS:SCOP  22->200 1fftC  f.25.1.1 * 5e-38 31.5 %
:HMM:SCOP  13->203 1m56C_ f.25.1.1 * 6.3e-55 35.6 %
:RPS:PFM   28->202 PF00510 * COX3 2e-24 41.3 %
:HMM:PFM   17->201 PF00510 * COX3 8.1e-34 31.9 182/258  
:BLT:SWISS 1->203 COX3_NOCFA e-117 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56572.1 GT:GENE BAD56572.1 GT:PRODUCT putative cytochrome c oxidase subunit III GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1876744..1877355 GB:FROM 1876744 GB:TO 1877355 GB:DIRECTION + GB:PRODUCT putative cytochrome c oxidase subunit III GB:PROTEIN_ID BAD56572.1 LENGTH 203 SQ:AASEQ MTTAVGTPGSAITQRVHSLNRPNMVSVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLKLAVPVTAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYEYYHLVHEGTSISSSAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFVR GT:EXON 1|1-203:0| SW:ID COX3_NOCFA SW:DE RecName: Full=Probable cytochrome c oxidase subunit 3; EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide III;AltName: Full=Cytochrome aa3 subunit 3; SW:GN Name=ctaE; OrderedLocusNames=NFA_17260; SW:KW Cell membrane; Complete proteome; Membrane; Oxidoreductase;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|COX3_NOCFA|e-117|100.0|203/203| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 27->49| TM:REGION 67->88| TM:REGION 102->122| TM:REGION 126->148| TM:REGION 150->172| TM:REGION 182->203| BL:PDB:NREP 1 BL:PDB:REP 28->201|1v54C|9e-26|37.4|171/259| RP:PFM:NREP 1 RP:PFM:REP 28->202|PF00510|2e-24|41.3|172/212|COX3| HM:PFM:NREP 1 HM:PFM:REP 17->201|PF00510|8.1e-34|31.9|182/258|COX3| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00510|IPR000298| GO:PFM GO:0006123|"GO:mitochondrial electron transport, cytochrome c to oxygen"|PF00510|IPR000298| GO:PFM GO:0016020|"GO:membrane"|PF00510|IPR000298| RP:SCP:NREP 1 RP:SCP:REP 22->200|1fftC|5e-38|31.5|178/185|f.25.1.1| HM:SCP:REP 13->203|1m56C_|6.3e-55|35.6|188/265|f.25.1.1|1/1|Cytochrome c oxidase subunit III-like| OP:NHOMO 976 OP:NHOMOORG 649 OP:PATTERN 11----1111111111--1-1---21111111------------------------------------ 1331111111111113211-151121111111322311111111111111112111111111111121111------------1---------------------111-2--------------11-------------11---111322111111121212221115341111111112112--------22222222222222222222222222212232111111113211111111111111111111--------------------------------------------------------------------------------------------------1---------------------1-1122111111115344211122122222222223-2242243333113222334343332111111212111211111111112212-1-111111111111111111111111-111111112-1333432222322333223533332334446551155422222212131321322121-------1232141-----11-1-111-------1--221211-----------------------------1112115122111222321222221122121--21-11-----11111111111111111-1111111111111111111111111111111111111111111111-111111111111111111111111111121112111---------------1111111---1122222322122222111-11111111-1--3-----221113322222222111111--111111-----------------------------------------------2- -3------1--------------------1-11111-------2-1--------121--------11---1-----1----------------1---11----111------1-111-----1-21-1-11--11-----1--11--------1-1----------12--5---111-----------1-1---2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 86.2 SQ:SECSTR ###########################HHHHHHHHHHHHHHHHHHHHHHHHcGGTcccccTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHTTTc# DISOP:02AL 4-5| PSIPRED ccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //