[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56576.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->57 PF11181 * YflT 0.00059 21.3 47/103  
:REPEAT 2|24->43|47->66

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56576.1 GT:GENE BAD56576.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1881255..1881470 GB:FROM 1881255 GB:TO 1881470 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56576.1 LENGTH 71 SQ:AASEQ MHRASREHQEERMSIIDKLKELVGKNPDRVKGGIDKAGDMFDQRTGGKYADHVDKGQQKAKDYLDRPNQQP GT:EXON 1|1-71:0| NREPEAT 1 REPEAT 2|24->43|47->66| HM:PFM:NREP 1 HM:PFM:REP 9->57|PF11181|0.00059|21.3|47/103|YflT| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------1------------------1------11111---------------1-11----------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 61-71| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccc //