[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56577.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   127->174 PF11740 * KfrA_N 0.00028 25.0 44/120  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56577.1 GT:GENE BAD56577.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1881528..1882085) GB:FROM 1881528 GB:TO 1882085 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56577.1 LENGTH 185 SQ:AASEQ MTVRGNRPRTGQPGPDDEERSISLRYFYDCEFIEDGRVIDLVSIGVVCEDGREYYAVSTEFDPERAGPWVRKHVLPQLPPPASPRWRSRAQIRDELYKFLIPRSSVQPELWAWVGAYDHVALCQLWGSMTDLPSLLPRYTNELRQHWEAHGRPELPPVPPDAHDALADARHNLAKFEAIEAARRR GT:EXON 1|1-185:0| SEG 79->90|pppasprwrsra| HM:PFM:NREP 1 HM:PFM:REP 127->174|PF11740|0.00028|25.0|44/120|KfrA_N| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111-111----------------11--111------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- DISOP:02AL 1-20, 184-185| PSIPRED ccccccccccccccccccccEEEEEEEEEEEEEccccccEEEEEEEEEccccEEEEEEccccHHHccHHHHHHHHHHccccccccEEcHHHHHHHHHHHHccccccccEEEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccEEEcHHHHHHHHHHHHHHccc //