[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56580.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->106 2kfsA PDBj 6e-24 48.1 %
:HMM:PFM   22->42 PF04539 * Sigma70_r3 0.00063 33.3 21/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56580.1 GT:GENE BAD56580.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1885764..1886132 GB:FROM 1885764 GB:TO 1886132 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56580.1 LENGTH 122 SQ:AASEQ MSAFPCSEDVLPASVTLLPLPEVADRLGIVVTRVHQMLRDHQLIAVRRDGVAGVPEVFFDDSGAVVKSLPGLITVMKDAKYTDEEILEWIFTDDETLPGKPVEALHGPLAREVLRRAAAEPF GT:EXON 1|1-122:0| SEG 109->120|larevlrraaae| BL:PDB:NREP 1 BL:PDB:REP 1->106|2kfsA|6e-24|48.1|106/146| HM:PFM:NREP 1 HM:PFM:REP 22->42|PF04539|0.00063|33.3|21/78|Sigma70_r3| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ----1111111--111111-11111111111111111111-1111-11-111111111--111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 86.9 SQ:SECSTR ccccccccccccTTccEEEHHHHHHHHTccHHHHHHHHHTTccccEEETTEEEEEGGGccTTccccTTHHHHHHHHHHTTccHHHHHHHHTccEEEEEEcHHHHHH################ DISOP:02AL 1-5| PSIPRED cccccccccccccccccccHHHHHHHHcccHHHHHHHHHcccEEEEEEccEEEccEEEEcccccccccccEEEEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccc //